(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE445

PENCW_16.PE445       Location/Qualifiers
FT   CDS_pept        1009315..1010277
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000202734" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129263"
FT                   /orf_name="Pc20g04450"
FT                   /product="Pc20g04450 protein"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /protein_id="CAP85774.1"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="InterPro:IPR002495"
FT                   /db_xref="UniParc:UPI0001831681"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDS1"
FT                   /transl_table=1
FT                   /translation="MVPHRNWAFTPYSRKVIAIVTCLALFLWVATPLGCYGSTDDSKPP
FT                   RYAFATVLMTENDTEFPDIEAPYFQAARLLTFQLLRNPRTRNRIDNVPFLILVTPDIPQ
FT                   RHRDALSREGATVVPMDNLNLDDGSSQRWNAVLTKLNLWKLVEYDKIVFLNVNSVIFRP
FT                   IYDIFEDPATNMRATVTPTAKMPKNYMIAAPHDSRTNSNAQLVLGQESYQKDHMNDGFF
FT                   ILHPSKDLYNYYVSLHHIRDKDESVHPEQDVLDYAHRADGPMPWQNLGPGWNLKDASRS
FT                   DYERGLESINHKWWRPIADDFVGGRIAMAMDEMTAYLNH"
     atggttccac atagaaactg ggcatttact ccttactcaa ggaaagtgat tgcaattgtc        60
     acttgtctgg ccctgttcct ttgggtcgca actcccctcg gctgttacgg atcaacagat       120
     gactccaagc caccccgcta tgcctttgcc accgttttaa tgacggaaaa tgacaccgag       180
     tttcccgata tagaagcgcc gtactttcag gcggcacggc tactcacctt ccaactactc       240
     cgcaatccgc gcacgcgaaa taggatcgat aatgtaccat ttctcatcct ggtcacaccc       300
     gatatacctc aaaggcaccg tgatgccctg agcagagaag gggctacggt ggtcccaatg       360
     gacaatctaa atctggatga cgggtcctca cagcgctgga atgccgttct caccaagttg       420
     aacctgtgga agcttgtaga gtacgacaaa atcgtgtttc tgaatgtgaa ctcggtcata       480
     ttccgtccta tctatgatat atttgaagat cctgcgacaa acatgcgtgc caccgtcact       540
     cctaccgcaa agatgccaaa gaactacatg atcgccgcac cacacgactc tcggacgaac       600
     tcgaacgcgc aacttgtgct cggtcaggaa tcttaccaga aggaccacat gaatgatggg       660
     ttctttattc tacatccctc aaaggatctc tataactact acgtcagtct gcatcacatc       720
     cgggataaag atgaatctgt tcatcccgaa caagatgttc tcgactacgc ccatcgggca       780
     gacggcccca tgccttggca aaatctcggg ccgggatgga acttgaaaga tgcaagccgg       840
     tctgattatg agcgcggatt ggaatcaatc aatcataaat ggtggcgccc tatcgcagat       900
     gattttgtag ggggtcgtat cgcgatggca atggatgaga tgactgccta cttgaaccac       960
     tga                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page