(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE448

PENCW_16.PE448       Location/Qualifiers
FT   CDS_pept        join(1014098..1014377,1014425..1014564,1014612..1014801,
FT                   1014854..1015491)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217306" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949955"
FT                   /orf_name="Pc20g04480"
FT                   /product="Pc20g04480 protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP85777.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="UniParc:UPI0001831683"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDS3"
FT                   /transl_table=1
FT                   /translation="MADSKNVALVFGASGISGWAVTKCALSYPTPTTFDRVIGLTNRPL
FT                   PLERSGLPHDPRLELHCGVNLRGNLDEVLCQLQEKVPSLEDVTHVYYLAYSNATAYSID
FT                   VMAIRDINEGMTYNAVHAVDRLCKNMKFFVLQTGTNNYGVAVFRFQEHIEINPPLHEDN
FT                   PRIPSPWGDEIFYYAQVDIIKEANKGKSWKWCEVRPDQIIGHVPTPTSMTYVEPLALYL
FT                   TLYRHVNGLGASVVFPGSYPNYTHTFTASSQDIIARSELYLSVEKPDRGHGEAFNTADN
FT                   DIPASWALVWPKMCEYFGLRGEGPSPEDKGWKDIDKWWFAHQDDYKKMCKKYGLRPREI
FT                   PETTWTFLSVGLSFLCRNRELSLDKIRSVGFTEEYPVAYGYFQVFERLTQEKIIPAKED
FT                   LYRYRVAEKGNLGMSL"
     atggctgatt cgaagaacgt tgcgttggtc ttcggggcca gcggtatctc cggctgggct        60
     gtcaccaaat gcgctctctc atacccaacg cccaccacct ttgacagagt gattggtttg       120
     acgaataggc cattgcctct ggagagaagt ggtctaccgc atgaccctcg actcgagttg       180
     cattgtggag tgaatttgcg gggaaatctt gacgaagtgc tgtgtcagtt gcaagagaag       240
     gttcccagcc tggaagatgt cacccacgtg tattatcttg cctactcaaa tgcaactgca       300
     tactctattg atgtgatggc tatccgggat atcaatgagg gaatgacata caacgccgtg       360
     cacgctgtcg accgcctatg caagaatatg aagttcttcg tgctccaaac tggaacaaac       420
     aattatggag ttgctgtgtt tcgcttccaa gaacacatcg agatcaatcc tcccttgcac       480
     gaggacaatc cgcgtattcc ctcgccctgg ggagacgaga tattctacta cgcgcaggtc       540
     gacataatca aggaagccaa taagggaaag tcttggaagt ggtgcgaggt tcgaccggat       600
     cagatcatcg gacacgtccc cacgcccaca agcatgacat atgtcgagcc tctggcgctc       660
     tacttgacgc tttaccgcca tgtaaacggc ctcggtgcct ccgttgtctt tccaggatcc       720
     tacccaaact atacccacac attcacggca tcctcgcagg atatcatcgc ccgttcggag       780
     ctctacctgt ctgtcgagaa gccggaccgg gggcacggag aggcattcaa cacggccgac       840
     aatgacattc ccgcgtcctg ggccctcgta tggcccaaaa tgtgtgaata ctttggttta       900
     aggggtgaag gcccaagtcc cgaggataag ggctggaagg atatcgacaa gtggtggttc       960
     gcacaccagg acgactacaa gaagatgtgc aaaaagtacg gtctgcgccc tcgcgagatt      1020
     cccgagacga cttggacttt cctttcagtg ggcttgagct ttctgtgtcg caaccgtgag      1080
     ctgagcttgg ataagatccg gagtgttggt ttcacagagg agtacccggt tgcgtatggg      1140
     tatttccagg tgtttgagcg cctgactcag gagaagatta ttcctgctaa ggaggattta      1200
     tacagatata gggtcgccga aaagggcaac cttggaatgt ccctttga                   1248
//

If you have problems or comments...

PBIL Back to PBIL home page