(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE45

PENCW_16.PE45        Location/Qualifiers
FT   CDS_pept        join(102765..102767,102844..102888,102944..103082,
FT                   103148..103326)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000159293" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824088"
FT                   /orf_name="Pc20g00450"
FT                   /product="Pc20g00450 protein"
FT                   /protein_id="CAP85374.1"
FT                   /db_xref="InterPro:IPR007808"
FT                   /db_xref="UniParc:UPI00018319E4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFE1"
FT                   /transl_table=1
FT                   /translation="MGKRKKSSSKPQGPRKREPLATTFSCLFCNHENSVVVKLDKKLGL
FT                   GDLSCKVCGQKFQTGINYLSAPVDVYSDWVDACDAVAKDTANQYDAPNPSQLGQRGISK
FT                   QAIPEETGQDDGYDDDY"
     atgggcaagc gcaagaagtc gagctcgaag ccccaggggc cccgaaagag ggagcctctt        60
     gctaccacat tctcctgtct cttttgcaac catgagaact ctgtggtcgt caagttagac       120
     aagaagctcg gcctaggcga cctatcgtgt aaagtttgtg gtcaaaagtt ccaaactggt       180
     atcaattatc tctctgcccc cgtggatgta tactcggatt gggtagatgc atgtgacgca       240
     gtcgcaaagg acactgccaa ccagtatgac gcaccgaacc caagtcagtt aggacaaaga       300
     gggatcagca agcaggctat tccagaagag actgggcagg acgatggcta tgatgatgac       360
     tactga                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page