(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE451

PENCW_16.PE451       Location/Qualifiers
FT   CDS_pept        join(1018886..1019254,1019314..1020365,1020453..1020531)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201423" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949957"
FT                   /orf_name="Pc20g04510"
FT                   /product="Pc20g04510 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP85780.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831685"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDS5"
FT                   /transl_table=1
FT                   /translation="MNDKKSKVFRKEGGDYEQGSIGDVVEGVPGTRILIEDTDAEIILL
FT                   PRPTSSPDDPLNWSWRRKYIAQAIVFIWAFMLGAATLSPAVTYASVMAELGASTSYLNI
FT                   GAALALLMLGLGNLVFNPLALRFGRRPVYLFSTLISAAAQVVAARAQTKATFIGSRILL
FT                   GFGAAPFEQLPALTVDDQFFIHQRGLGLSIYTLALTTGSFLGPIATGFVIDSMGWRCPS
FT                   SFPLQSSPAQLTVQIGVYWFYAIFLFSVAALVFFALEETGFPRRTYQQTDPNETRSSDP
FT                   PKTYLQKLQLITILPVPTSLYRTATTPILLLTSPIIWWCGIMYGFAVAWLTIMAYESTT
FT                   IFMTYNFSSSALGLTNIAPLIGACLVIYLGGAGTDRFMVFKARRNAGIMEPETRLYSVF
FT                   FAGPIMAAGLILYGVGAANEIHWAGPIIGMGMIGSALPISAEVALGYVSECYPSLAGEA
FT                   TAAVIVIRNVIGCGMTGILLVWKGKACRRLGARRYATLVLG"
     atgaacgaca aaaaatccaa agtattccgg aaagagggag gagactatga acagggctcc        60
     attggtgatg ttgtcgaagg tgtcccaggg acccgtatcc tgattgagga caccgacgcc       120
     gagatcatcc ttttaccccg tcctacctct tccccggacg atcccctcaa ctggagctgg       180
     aggagaaagt atattgccca ggcaatcgta tttatatggg cattcatgtt aggagctgca       240
     accctatcac cggctgtgac ttatgcatcg gtaatggccg agcttggagc gtcgacgagt       300
     tatctaaaca tcggcgctgc attggctttg ctgatgctgg gtctgggaaa tctagtcttt       360
     aaccccttgg ctttgaggtt cggtagacga cctgtctacc tcttctctac ccttatcagc       420
     gcagcagcgc aagtggtagc cgcgagagcg caaaccaagg cgacatttat cggcagccgc       480
     attttgctag gttttggagc agctcccttc gagcaacttc cagcattgac agtagacgac       540
     cagttcttta tccaccagcg aggtctcgga ttgtctatat acacgcttgc ccttactacg       600
     ggctcattcc tcggtcccat tgcgacgggt ttcgtgatag actcaatggg atggagatgt       660
     ccgtcatcat ttcccctgca gtcttccccc gcacaactga ccgtacaaat aggggtctac       720
     tggttctacg caattttcct cttcagcgtc gcggctctcg tctttttcgc cttggaagag       780
     accggcttcc ccaggcgcac ctatcagcaa accgacccaa acgaaacccg gtcctccgat       840
     cccccgaaaa cttacctcca aaaactgcag ctcatcacca tcctccccgt cccgacctcc       900
     ctctatcgaa cagcaaccac tcccatcctc ctcctcacct cccctataat ctggtggtgc       960
     ggcatcatgt atggcttcgc cgtggcctgg ctaacaatca tggcctacga atccacaaca      1020
     atcttcatga cctacaactt ctcctcctcc gccctgggcc taacaaacat cgcccctctc      1080
     atcggtgcct gtctggtaat ctacctcggc ggcgccggca cagaccgctt catggtcttc      1140
     aaagcccgtc gaaatgctgg cattatggag cccgagaccc ggctgtactc cgtctttttt      1200
     gcgggtccca tcatggccgc cgggctgatc ctatacggcg tcggtgcggc gaatgagatt      1260
     cactgggcgg gtccaattat aggcatgggc atgattgggt ctgcgctccc gatcagcgcg      1320
     gaggtcgcgc tggggtatgt gagtgagtgt tatccttccc tggcggggga ggcgacggcg      1380
     gcagtgatcg tgattcggaa tgtgattgga tgtgggatga ctggaatttt gcttgtctgg      1440
     aaggggaagg cttgtcggcg gctgggggca cggaggtacg ctactttggt tttggggtag      1500
//

If you have problems or comments...

PBIL Back to PBIL home page