(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE452

PENCW_16.PE452       Location/Qualifiers
FT   CDS_pept        join(complement(1022614..1022654),
FT                   complement(1022465..1022557),complement(1021675..1022410))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824907"
FT                   /orf_name="Pc20g04520"
FT                   /product="Putative uncharacterized protein Pc20g04520 "
FT                   /protein_id="CAP85781.1"
FT                   /db_xref="UniParc:UPI0001831686"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDS6"
FT                   /transl_table=1
FT                   /translation="MSVTYHVYHPSHDRYMDPSGNSTSSQHIPSKFLGPVMFHHPSDDL
FT                   QLDHMLLRLPFYMFVSFFPSALIPAHCVLRLGQHEKGLTIHRHVARPPPHKTLHSNWVV
FT                   QPCRDTRKRKKQKQKQKACTFRRFNQAPTFKHQNPNIHFDQPHSVNHIQSTTSTVNHIQ
FT                   STTSRVNHIHSQPHPQSTTSTVNHIHSQPHPQSTTSTVNHPLQSTFQSTFQSTFQSTFQ
FT                   STFQSTFQSASSINHFNQPLQPTIRLSTTLQLCKRRKETKQSWSTRVSAGVSLKETSRR
FT                   EEVQRVPI"
     atgtctgtca cctatcatgt ctatcatcca tcacatgacc gttacatgga tccttcaggc        60
     aactcaacct catcacaaca tatcccctca aaattcctgg gacctgtcat gtttcatcat       120
     ccatcagatg acttacaact cgaccacatg ctccttcgtc ttccatttta catgttcgtt       180
     tcctttttcc catctgctct tatcccggct cattgcgttt tacgactcgg tcaacatgag       240
     aaggggctga ctatacacag gcatgttgct cgaccacctc cacacaagac tctccactca       300
     aactgggtgg tccagccttg ccgggacacc agaaaaagaa aaaaacaaaa acaaaaacaa       360
     aaagcctgta catttcgccg cttcaaccaa gcacccacat tcaaacatca aaacccaaac       420
     atccacttcg atcaaccaca ttcagtcaac cacatccagt caaccacatc cacagtcaac       480
     cacatccagt caaccacatc cagagtcaac cacatccaca gtcaaccaca tccacagtca       540
     accacatcca cagtcaacca catccacagt caaccacatc cacagtcaac cacatccaca       600
     gtcaaccatc cacttcaatc aacatttcaa tcaacatttc aatcaacatt tcaatcaaca       660
     tttcaatcaa catttcaatc aacatttcaa tcagcctctt caatcaacca cttcaaccaa       720
     ccgcttcaac caaccatacg cctatccaca acgcttcaac tttgcaagag gaggaaagaa       780
     acgaagcagt cttggtcgac tagagtctcc gcaggagtgt ctctgaagga gacttctcga       840
     cgggaagagg tgcagcgtgt acccatttga                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page