(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE453

PENCW_16.PE453       Location/Qualifiers
FT   CDS_pept        join(1022850..1022905,1023007..1023126,1023392..1023470,
FT                   1023555..1023659,1024020..1024157,1024244..1024290,
FT                   1024374..1024437,1024525..1024742,1024846..1024956,
FT                   1025032..1025151,1025242..1025553,1025773..1026115)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129264"
FT                   /orf_name="Pc20g04530"
FT                   /product="Putative uncharacterized protein Pc20g04530 "
FT                   /protein_id="CAP85782.1"
FT                   /db_xref="UniParc:UPI0001831687"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDS7"
FT                   /transl_table=1
FT                   /translation="MEEVMRLKLMMEDLMEDKGGYLYPGGLERVWRVRKYPCTWGVLQG
FT                   TPHFSTSPLQLSAPLHAKLYLVWRICTVLVSRRTTFEGPKSWLASICEWAPVHIMSEVA
FT                   LSPHGHFRWRQNAETPGNKRGLGYEVDTIWDFRGPRRYCRLELHRDRGVMNCSLQGDRM
FT                   YEAMRGADREGNRTSEKHWFVGGIEKGAGENSVLGLPEGVGSAMYSVNKDQLKLAKVKE
FT                   KLRGVYRRRDPVRTHDSRRGRKEGVRCALWMKLADENIPVSCWFRRGIVMETARTRKGI
FT                   KKQSVLSEWKLYKRARESARDQAIGEAFMPNNPQGHCSKYSRPVKGRMDDNGSIGMEEG
FT                   YTPIDSPGSWATSEDNARQCERTGHLSPPLSIFTDESECNRRIGATAVRYTVSFERRCQ
FT                   MGDEDMSTVYQPSSKTSKWPCSRFKKPGTGQWGGRVDGDGGEESEESEGIGKPDRITSR
FT                   GISGWLRKMVTVTKASSILFVAGFMMKPALLAQFQCVDSMATGIRLPRLLVRAVHNHST
FT                   TITITLAGISASSVTTITSCPAPAGGLRHRSTSCYARKRTTLLGTGPANPHNH"
     atggaagaag tgatgaggct taagctgatg atggaagacc tgatggaaga taaagggggg        60
     tatttatacc ctgggggtct ggagagggtc tggagggtca ggaagtaccc ttgtacctgg       120
     ggtgtcctcc aggggacccc ccatttttca acttcccctc ttcaactatc tgccccgtta       180
     cacgctaagc tgtatctggt atggcgcata tgcacggtcc ttgtgtcacg tcgtacaacc       240
     ttcgaaggtc ccaagtcgtg gcttgctagt atctgcgagt gggctccagt acatatcatg       300
     tctgaggtcg cattgtcccc acatgggcat ttccgatgga gacagaacgc ggagacaccg       360
     gggaacaaga ggggcctagg atatgaggtg gatactattt gggactttcg aggacctaga       420
     cggtactgtc ggcttgaact acatcgcgac cgaggagtaa tgaattgcag tctacagggc       480
     gacagaatgt acgaagcgat gaggggggca gatagagaag ggaaccgaac cagcgagaag       540
     cattggtttg tcgggggtat tgagaaaggg gcgggtgaga attcggttct cgggttgccg       600
     gaaggcgtgg ggagcgcgat gtactctgtc aataaagatc agttgaagct cgcgaaagtg       660
     aaggagaagt tacgaggtgt gtatcgtcga cgagacccag tgcgaactca cgatagtagg       720
     agaggaagga aggaaggcgt gcgttgtgca ttgtggatga agctcgctga cgagaatatc       780
     ccagtatcgt gctggtttcg tcgtggaatt gtgatggaga cagcgaggac cagaaagggc       840
     ataaagaaac agtctgtatt aagcgaatgg aagctatata aaagggcaag agagtcagca       900
     agagaccaag ctataggaga agcatttatg ccaaacaatc cccaaggtca ttgctccaag       960
     tatagccgac cggtcaaagg gaggatggac gataatggaa gcattggtat ggaagaaggg      1020
     tacacgccaa tagattcccc gggatcctgg gccaccagcg aggacaacgc acgacaatgt      1080
     gagagaactg gccacctctc ccctcccctc agtatattca ctgacgaaag tgaatgcaac      1140
     aggcgcatag gcgctacagc cgtgagatat acggtaagtt tcgaaaggcg atgccagatg      1200
     ggagacgaag acatgtccac cgtgtaccag ccgagctcaa agacgtcgaa atggccctgc      1260
     agcagattca agaagcctgg tacgggacag tggggaggac gagtggacgg ggacgggggc      1320
     gaggaaagcg aggaaagtga ggggatcgga aagcctgatc gaattaccag ccgtggaata      1380
     tcaggatggc ttcgcaagat ggtgacagtc actaaggcat cctcaatcct attcgtggca      1440
     ggtttcatga tgaagccggc cctcttggca cagtttcagt gcgtggactc catggccaca      1500
     ggcataagac taccacgact gctggtgagg gcggtacaca atcatagcac caccatcacc      1560
     atcactttag ctggtatcag cgcgagttcc gtcacgacga ttacaagctg tcctgcccct      1620
     gcgggagggc taaggcaccg gagtacatcg tgctatgcca gaaagcgcac cacactttta      1680
     gggactggcc cagcaaaccc ccataaccac tga                                   1713
//

If you have problems or comments...

PBIL Back to PBIL home page