(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE454

PENCW_16.PE454       Location/Qualifiers
FT   CDS_pept        join(complement(1027241..1027376),
FT                   complement(1026818..1027160),complement(1026578..1026711),
FT                   complement(1026400..1026489),complement(1026142..1026323))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949958"
FT                   /orf_name="Pc20g04540"
FT                   /product="Putative uncharacterized protein Pc20g04540 "
FT                   /protein_id="CAP85783.1"
FT                   /db_xref="UniParc:UPI0001831688"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDS8"
FT                   /transl_table=1
FT                   /translation="MVHYCKTAKYSNVALAESTKIPPDKPHNAVLGLFISSLVSGLRLT
FT                   VFRLSHLAPVSSLPPSMARAVRYIGIAAHSLHSPHLAYIAQLPGSLYLHFSIRSLPASS
FT                   PPSTSYYQSSPSPRVPTSLLKPTNAVAFVNSMACPFILDPVVDIVDFARGISRLDGFKV
FT                   VVVVVVIVVLIKVYRRAGVAHTPATSLGVLGRAELWNYVHEYECSYLQSQGIPVVSFVS
FT                   WCSVAGDVAPVYLSVGGMVLDEGSGEVRVGQPAFLGSPAALVSARGLSPCADCGVEAGD
FT                   TEEFAELGRADPA"
     atggtccact attgcaagac agcaaaatac tcaaatgtgg ccttagcaga gagtacgaaa        60
     attcccccgg ataaaccgca caacgcagta cttggactct ttatctcttc gctggtttca       120
     ggcctgcggt taaccgtgtt ccgactgtcg catctagcgc cagtctcgtc tttaccacct       180
     tccatggccc gtgccgttcg ttatattggt atcgccgcac attccctcca tagcccgcat       240
     ttggcctaca ttgctcaatt gcccggatct ctctatctgc acttctccat ccgttcttta       300
     ccggcatcct cacccccgtc gacctcgtat taccaaagct cgccatctcc ccgcgttccc       360
     acgagtctcc tgaagcccac aaatgcggtt gccttcgtga attctatggc ttgccccttc       420
     atcctcgacc ccgtcgttga tatcgttgat ttcgcccgcg gaattagccg cttggatggg       480
     tttaaggtgg tggtggtggt ggttgttatt gttgtattaa ttaaggtcta tcggagagcg       540
     ggcgtagccc acactccagc tacctccctt ggggtattgg gacgtgctga gctatggaat       600
     tatgtacatg aatatgaatg cagttatctc cagtcacaag ggattcctgt cgtatcgttc       660
     gtgagctggt gctcggttgc gggcgatgtt gcgcctgtgt atctgagtgt cgggggaatg       720
     gtgcttgacg aagggagtgg agaagtgaga gtgggacagc ctgccttttt gggaagccct       780
     gcggctcttg taagtgcccg agggttgtca ccttgtgcag attgtggcgt agaagccggt       840
     gatacggagg agttcgccga actcggtagg gccgaccctg cgtag                       885
//

If you have problems or comments...

PBIL Back to PBIL home page