(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE455

PENCW_16.PE455       Location/Qualifiers
FT   CDS_pept        join(1027580..1028247,1028301..1029002,1029050..1029926)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000206405" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672208"
FT                   /orf_name="Pc20g04550"
FT                   /product="Pc20g04550 protein"
FT                   /function="binding"
FT                   /protein_id="CAP85784.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI0001831689"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE27"
FT                   /transl_table=1
FT                   /translation="MDTHDVSDVPEYFRYLQAQKQNLKNAQAVKGRPARSPKSKDEILM
FT                   QFMFRQMMRKEAPASPMNIRSSFLPPAYPPCVSPFSKLKKVMIESLRLETHHRERYLLL
FT                   RTVTSTDTMTAVMAIVEDEDGSVLMLQLYNQEEQLSGAQSLREGTVLVVKEPYVKVMAD
FT                   GDYGIRVDHLSDVSFIPEFDDLVPLPWRKRVTQADGNASSWKEKGSEHFEKGDYHSAIQ
FT                   CYSKALETHPSPEVLVIAQLNRALSLLKSYSFDAALGDVEDVLQVSEMSEKALFRKAQA
FT                   LYQLRRLNESCQTHEILAEKYPDNTLAAHEYARASARLVEQDSGKYEFRKMILEAKKRQ
FT                   PPRLDRGTYIGPVTVKQTQSHGRGLFTTQAVKAGDLLFCEKAFAHAFHDENGSKDLRLL
FT                   LNVDMDEATIGTQGELIGLIVQKLSKNPSLLPGFVDLHHGTYKSLDVLEVDGIPIVDTF
FT                   LVERIILLNSFGCPLLSRESHIRTVKGDDDKDKESNKQFHSSGVWPMASYINHSCLSNA
FT                   RRSFIGDMMIVRASRDLPPNTEITFWYKSPMTRDPKESPVNLQHWGFKCDCIFCQDTRS
FT                   VSGSVLSNRNRISSDLRRLFKTSKMNLRKIEDKISTLASTYCRPASEVPRLALDSPYLS
FT                   LAAIYASSRNHKKAVEFGLMCLESLGFVVKGGKIPHVSEVPLVVQKWGLMTDGVVGCWM
FT                   ILCSAYQELAPILASQAEEYARVSYRICVGEDETFDRTYSRLSNRVDGFLMTAK"
     atggataccc acgatgtctc cgatgttcca gagtactttc ggtatcttca agcacagaag        60
     caaaatctga aaaacgcgca ggcggtcaag ggccgtccag caagatcccc taagtccaaa       120
     gatgaaatct tgatgcagtt catgtttcga cagatgatga gaaaggaagc tcctgctagt       180
     ccgatgaata tccgatcctc gttcctacca cctgcctacc ctccatgcgt tagtccgttc       240
     agcaagttaa agaaagtcat gatcgaaagc ctacgtcttg aaactcatca tcgggaacgg       300
     tatctccttc tgagaacagt cacttcgaca gatacgatga ccgctgtgat ggccatcgta       360
     gaagatgaag acgggagtgt tctcatgttg cagctctaca accaagagga gcagctatcg       420
     ggcgcacaga gcctgagaga gggtacagta cttgttgtga aagagcccta tgtgaaagta       480
     atggcagatg gagactacgg gattcgcgtg gaccatctct cggacgtctc gtttatcccc       540
     gagtttgacg acctggttcc cttaccctgg aggaagcgtg tcacgcaagc tgatggaaat       600
     gcctcttctt ggaaggagaa aggaagtgag cattttgaga agggtgacta tcattcggca       660
     atccagtgtt actcaaaggc tttggaaacc cacccctcac cggaagtact ggtgatcgcg       720
     cagctcaacc gtgccctttc ccttttgaaa agctacagct ttgatgcagc gttgggagac       780
     gtcgaagatg tcttgcaagt atcagagatg tcggaaaagg ccctttttag gaaggctcaa       840
     gccctgtatc aacttcgaag gttgaatgaa tcatgtcaaa ctcacgaaat acttgcagag       900
     aagtatccag ataataccct ggctgcacat gagtatgcac gagcgtctgc tcggcttgtg       960
     gagcaggata gcggcaaata cgagttcagg aaaatgatac tggaggccaa gaagcgtcag      1020
     cccccgaggc ttgaccgcgg cacctacatt ggtcctgtga ctgtcaagca aactcagtct      1080
     catgggaggg gacttttcac aacacaggcg gtaaaggcgg gcgaccttct gttctgcgaa      1140
     aaggcatttg ctcacgcgtt ccacgatgaa aatggctcga aagatctccg tctgttactc      1200
     aatgtcgaca tggacgaagc taccattggt acccaaggag agcttatcgg attgattgtt      1260
     cagaaacttt ccaaaaatcc gtccctgctg ccaggatttg tcgatcttca tcatggcaca      1320
     tacaaatcat tggatgtcct agaagtggat ggtataccca tcgtagatac cttcctcgtt      1380
     gagagaatca ttctcctaaa cagtttcgga tgccctcttc tctcccgtga gagtcacata      1440
     cgcaccgtga aaggggatga tgataaggac aaagagtcca ataaacagtt ccattctagt      1500
     ggggtctggc cgatggcatc atatatcaac cactcttgcc tgagcaatgc tcgtcgttct      1560
     ttcattgggg acatgatgat tgttcgtgct tcgagagacc tgccgcctaa cactgaaatt      1620
     accttctggt acaaatcgcc catgacccgt gatcctaaag aatcacctgt caacctacag      1680
     cactggggct tcaagtgcga ttgcatattc tgccaggaca caagaagtgt tagcgggagt      1740
     gttctatcaa accgaaacag aatttcatct gaccttcgaa gattattcaa gacatccaag      1800
     atgaatctgc gaaagattga agacaaaatt tccaccctcg caagcacata ttgccgacca      1860
     gcttctgaag tccctcgtct tgcacttgat tccccatacc tgtctcttgc tgccatctat      1920
     gcttcatccc gaaaccacaa aaaggccgtg gagtttggat tgatgtgcct agagtcacta      1980
     ggcttcgttg tcaaaggtgg gaagattcct catgtctcag aagtcccatt agttgtccaa      2040
     aaatggggcc taatgactga cggagttgtg ggatgctgga tgattctgtg cagtgcatat      2100
     caagagctcg cccctattct cgcgtcccaa gctgaggaat atgccagagt atcctacaga      2160
     atctgcgttg gcgaagatga gactttcgat cggacctaca gcaggctatc gaatcgggtg      2220
     gatggctttt tgatgactgc aaagtag                                          2247
//

If you have problems or comments...

PBIL Back to PBIL home page