(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE456

PENCW_16.PE456       Location/Qualifiers
FT   CDS_pept        join(1030473..1030614,1030661..1030848)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000185320" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129265"
FT                   /orf_name="Pc20g04560"
FT                   /product="Pc20g04560 protein"
FT                   /protein_id="CAP85785.1"
FT                   /db_xref="InterPro:IPR011058"
FT                   /db_xref="UniParc:UPI000183168A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE28"
FT                   /transl_table=1
FT                   /translation="MSFHRSACDIRLRADSGCTFLSAICNNEEGSGLADNIPLDECLGN
FT                   ENGHFSWGGRNFSHDARNITLTRGPDRSPVLHSDLRNSSGDFVPSEIDLATHIANIDGK
FT                   LVYLY"
     atgtctttcc accgcagcgc gtgtgatatt cgtctaaggg ccgactccgg ttgcactttc        60
     ttgtccgcga tttgcaacaa tgaggagggt agtggtcttg ccgacaatat ccctcttgat       120
     gaatgtctcg gaaatgaaaa tggccatttc agttggggtg ggagaaattt cagccacgat       180
     gcacgtaata tcacccttac tcggggacca gatcgatcgc ctgtccttca ttctgatctc       240
     cgaaactcct ccggcgattt tgtacccagc gaaattgatc tggctacgca catagccaat       300
     atcgacggca agcttgttta cttgtactaa                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page