(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE458

PENCW_16.PE458       Location/Qualifiers
FT   CDS_pept        join(complement(1032658..1032835),
FT                   complement(1032329..1032606))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949959"
FT                   /orf_name="Pc20g04580"
FT                   /product="Pc20g04580 protein"
FT                   /function="RNA binding"
FT                   /function="ribonuclease III activity"
FT                   /biological_process="RNA processing"
FT                   /protein_id="CAP85787.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004525"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="UniParc:UPI000183168B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE29"
FT                   /transl_table=1
FT                   /translation="MGAELESLIGYQFHDRSLLEEALEEAGPQTEGNERLALLGDKVLS
FT                   LMLLHRWYMEGNTTEQGTNLLQIYAGNKHLISRARALDFPKFVIQRLDIKRSVPDHTLA
FT                   TTVKAILGAVWLDSEESVRNVKNSMERIGLYPPEISLYPPKFGNQKQ"
     atgggagcag aactggaatc tttgattggc taccagtttc atgatcgaag tttgctggag        60
     gaggccttag aagaggccgg accacagact gagggaaacg agcggttggc cttgttagga       120
     gacaaagttt tatcactcat gctgcttcat cgttggtata tggaaggaaa caccactgag       180
     caagggacga acctacttca gatctacgcc ggcaataagc acttgatctc tagagccagg       240
     gctttggatt ttccgaaatt cgtaatccaa agactagaca taaagagaag tgtgccagat       300
     catacacttg ctaccacggt gaaggcaatt cttggtgctg tttggcttga ttccgaggaa       360
     agcgtacgga atgtgaagaa tagcatggag agaatcggtc tttatcctcc cgaaatcagc       420
     ctttatcctc ctaagttcgg caaccagaag caatag                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page