(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE459

PENCW_16.PE459       Location/Qualifiers
FT   CDS_pept        1034337..1034975
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129266"
FT                   /orf_name="Pc20g04590"
FT                   /product="Pc20g04590 protein"
FT                   /function="signal transducer activity"
FT                   /protein_id="CAP85788.1"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="InterPro:IPR000342"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="UniParc:UPI000183175E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE30"
FT                   /transl_table=1
FT                   /translation="MSYASRSNSKELVKRPTLSEVLSDATAPPYTLKAFMTYLSESHCL
FT                   ETLQFTLAAKEYCETYNSFVDQAGEPNVTTDPSAGRHLRMLYQLLLTTYIIPGAPREVN
FT                   LSSDMRDSLLRYKDQLTPPLPEVLEPGVRYIQELMENSIFLLFLNSCATPSCQDLAPEA
FT                   SDMIGVSVDSSVRRSGDESTQSVRVNSKRPFLSHHMRSWSWPPWGRQPD"
     atgtcatacg catctcgctc taattcaaaa gagttagtca agcgaccaac ccttagtgaa        60
     gtattgtctg atgccacggc cccaccatat acccttaagg cattcatgac atacctctcc       120
     gaaagccatt gcctcgagac gttgcagttt accttagcag caaaggaata ctgcgaaact       180
     tataactcat tcgtcgatca agcgggtgaa cctaatgtta cgaccgaccc ctcggcaggc       240
     aggcacctgc gcatgcttta tcagctcctt ctgacgacgt acattatacc cggagcgccc       300
     cgtgaagtca acttatcatc cgacatgcgc gattctctcc tacgatataa agatcaattg       360
     acaccccccc tacccgaggt tcttgagcct ggcgtgagat atatccagga actgatggaa       420
     aattctatat ttcttctgtt tctgaatagc tgcgctaccc cttcgtgtca agacctggcg       480
     ccagaggcat cagatatgat cggcgtcagc gtggattcct ctgttagaag gtcaggggat       540
     gaatccacgc agtcggtccg cgtgaattcc aagcgcccat tccttagcca ccatatgaga       600
     tcttggtcat ggcccccttg gggtcgtcag cccgattga                              639
//

If you have problems or comments...

PBIL Back to PBIL home page