(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE46

PENCW_16.PE46        Location/Qualifiers
FT   CDS_pept        join(complement(104422..104579),complement(104003..104361),
FT                   complement(103774..103945),complement(103668..103719))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000262755" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946689"
FT                   /orf_name="Pc20g00460"
FT                   /product="Pc20g00460 protein"
FT                   /protein_id="CAP85375.1"
FT                   /db_xref="UniParc:UPI00018319E5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFE2"
FT                   /transl_table=1
FT                   /translation="MASKPESGPSPAQGVGPLYRPDGEKPTATVSKEVSYDNVHVLPQT
FT                   PQLIALLTMIRDKRTSRADFIFYSNRIIRLLVEEGLNHLPVVEQSITTPVGRSYLGVKF
FT                   EGKICGVSIMRAGEAMEQGLRDCCRSVRIGKILIQRDEESCMPKLFYDKLPSDIADRWV
FT                   LLLDPMFATGGSATLAVETLIERGVPEHRILFLNLIASPSGVAEFAERFPKLRVVTSFI
FT                   DQGLDEKKYIIPGLGDFGDRYYSM"
     atggctagca aaccagagag cggtccctct cctgcgcagg gcgttggtcc tctgtatcgg        60
     cctgatggcg agaagcccac tgcgacagtt tcaaaggaag tttcctacga caatgtccac       120
     gtgctacctc aaacacccca gttgattgct ctcttgacga tgatcagaga caagagaacc       180
     agccgtgctg atttcatctt ctattccaac cgcatcattc ggttgctggt ggaggaaggc       240
     ctgaaccacc tccccgttgt tgagcagtca atcactaccc ccgttggacg gtcctacctt       300
     ggtgtcaaat ttgaaggaaa gatctgcggt gtgtctatca tgcgcgcagg cgaggccatg       360
     gaacaaggat tgcgcgactg ctgccgatct gttcgcattg gaaaaattct catccagcgg       420
     gacgaggaga gctgtatgcc caaactgttt tacgataagc ttcctagtga cattgctgat       480
     cgatgggtcc ttctcctcga ccccatgttt gcaactggtg gttctgcaac tctggcagtg       540
     gagacactga tcgagagagg tgttcctgaa cacaggatcc tattcctcaa ccttattgcc       600
     agcccgtctg gtgttgctga gtttgcggag agattcccta aactccgggt cgtgacctct       660
     ttcattgatc aaggattgga tgagaagaag tatattatcc ccggcctggg agatttcggc       720
     gacagatatt actctatgta a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page