(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE460

PENCW_16.PE460       Location/Qualifiers
FT   CDS_pept        join(1036195..1036286,1036346..1036658)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187032" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129267"
FT                   /orf_name="Pc20g04600"
FT                   /product="Pc20g04600 protein"
FT                   /biological_process="fruiting body development "
FT                   /biological_process="hemolysis by symbiont of host
FT                   erythrocytes"
FT                   /protein_id="CAP85789.1"
FT                   /db_xref="GO:0019836"
FT                   /db_xref="GO:0030582"
FT                   /db_xref="InterPro:IPR009413"
FT                   /db_xref="UniParc:UPI000183175F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE31"
FT                   /transl_table=1
FT                   /translation="MASSLSQKSLQIQIQDDLKYDIRIENAKLESGKFYNEDDQSDILT
FT                   SEDVDDMVIRHNGGIRSVCSMDGSEGSIDLVDDVRDAKICNLTWRASPEGGERNEIKKL
FT                   NEDTRYMVDIGSWNESGTVGSVLVTVKDQE"
     atggcctctt cactatcgca gaagtccctg cagattcaaa ttcaagatga cttgaagtat        60
     gatatccgta tcgaaaatgc taagcttgaa agcggcaaat tctacaatga ggatgaccaa       120
     agcgatatct taacatcgga agatgtcgat gacatggtta ttcggcataa cggtgggatc       180
     cggtctgtct gctctatgga cggatctgaa ggaagtatcg atcttgtcga cgatgtacgg       240
     gatgcgaaga tttgcaattt aacctggaga gcctccccag agggtggaga acgtaatgag       300
     atcaagaagc tcaacgaaga tacgaggtac atggttgaca ttgggagttg gaatgaatcc       360
     gggactgtag gatcagttct tgttaccgtc aaggaccaag agtga                       405
//

If you have problems or comments...

PBIL Back to PBIL home page