(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE461

PENCW_16.PE461       Location/Qualifiers
FT   CDS_pept        complement(1037206..1040700)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200201" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672209"
FT                   /orf_name="Pc20g04610"
FT                   /product="Pc20g04610 protein"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /function="phosphomevalonate kinase activity"
FT                   /biological_process="cholesterol biosynthetic process "
FT                   /biological_process="nucleoside metabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP85790.1"
FT                   /db_xref="GO:0004631"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006695"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005919"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016168"
FT                   /db_xref="UniParc:UPI0001831760"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE32"
FT                   /transl_table=1
FT                   /translation="MATLESLKLALRQKATEKASTSKQPLSDAQYSAGFDTFVQGSGWM
FT                   TYRDFILPQICQLLTQLLGSRSCISVLEIGPGPKSILGHLPSDLRRKVKRYSAFEPNNL
FT                   FATKVQKWLSFESDIESPFPCLERTPDIHRTPFIVNSPTGGDTGSVTRDSDEKFDVIIF
FT                   CHSMYGLNPKAKFIEQALQMLVEQPKSGIVVVFHRDGTLNLDGLVCNETAPFPTGTISV
FT                   PNNDAVLDLFAPFVAGFAMQDKEADKVLLAEWREVCRVLSRREETHPGHLFFSSPNLMA
FT                   TFTRQSTALPELTAQVPLLEGDLKVKNREARLHYPASIFRPTEIRHVQDCIRWALKHGV
FT                   GLTVVGGGHSGHCLWDNVVAVDMGAFDQVHVLQARNGGAESGFDCTPLVVAEAGCKTGD
FT                   IIRNAMAMGITVPLGARPSVGAGLWLQGGIGHLARMYGLACDAIVGAVIVSVDSSQVFC
FT                   IGHVPSQHQPVGAVRPGNETDLLWGIKGAGTNFGIVVSVTFKAFPSPTYSVRNWIAPLN
FT                   DSLEAQVKLSEFDEYVARRLPRNCSADAYLYWDIGQLRLGVTMFESFETRPSSETPIPF
FT                   PLPTSSGTILGPEDNFKFVDGVGLFEAEMYMSGMHGGHGGSRTSSFKRCLFLKDIGAPE
FT                   VTNSLVTAIKTRPSPLCYLHLLQGGGAVVDVAADAAAFGCRDWDFACVVTGVWSRDQDG
FT                   TEVARTAVRWVYSIAMDLLPLSSGVYGADLGPDPRDAALAVEAFGPNRPRLARLKQSSD
FT                   PRNVLAYTCPLEQVPIKPKLIILVTGDSCAGKDYCANIWVSAFLECTQKSLVARAVSIS
FT                   DTTKREYAAATGADLNRLLCDRAYKEQHRPALTTFFQSQVRHRPRLPEEHFLKAVYGAV
FT                   DTDVLLITGMRDDAPVATFSHLVPDSRLLEVCVEASKPTRCTRRGCQDGDGADHHADNN
FT                   NSWSKPKPLDYRPSLIFNNDLTGSEAAQRFAELNLLPFFHKDLQRLADMVRPVSNFPRP
FT                   GVEFRHVLNISQQRGGLTLCTYLLQTHFAGAWGEVDVLACCEAGGFVYASALALQVNVP
FT                   LALIREAGKLPTPTVSIFKPTSHISSSTSDDLEGSRIEMERDLIPKGASVVVVDDVLAT
FT                   GKTLCAVLDLLNKANICAKDVSIMVVAEFPVHRGRELLRQRGFGGVNIQSLLVFGGA"
     atggccaccc tcgagtctct caaattggct ctcaggcaaa aggccacaga aaaagcgtca        60
     acctcaaaac aaccattgtc ggacgcgcag tacagcgctg gattcgatac ctttgtgcag       120
     ggctcaggat ggatgacata ccgagacttt attcttcctc aaatttgcca gctgttaacc       180
     caacttctcg gctcgcgtag ctgtatttcg gtgctagaaa ttgggccggg tccgaagagc       240
     atacttgggc atcttcctag cgatctgaga aggaaggtta agagatattc tgcgtttgag       300
     cctaacaacc tgttcgctac caaagtgcaa aaatggcttt cttttgagtc ggacatagag       360
     tctccatttc catgtctgga acgtacgcct gacattcacc ggacgccatt cattgtgaac       420
     agccctactg ggggcgatac aggcagcgtt acgcgtgaca gcgatgagaa attcgacgtt       480
     attatatttt gccacagcat gtacggctta aaccccaaag ccaagttcat cgaacaagca       540
     ctgcaaatgc ttgttgagca gcccaaaagc ggaatagtgg tagtgttcca tcgggatggg       600
     actcttaacc ttgacggatt agtttgcaat gaaacggctc cgttccctac cggaactatt       660
     agtgtgccga ataacgacgc ggtactggac ctttttgcgc cttttgttgc agggtttgcc       720
     atgcaggata aggaggcaga caaggttctc ctggcggaat ggcgtgaggt gtgccgcgtc       780
     ttgagccgtc gcgaggaaac tcaccctggg catctcttct tcagctcgcc caacttaatg       840
     gcaactttta ccagacagtc gacagcatta ccagagctga cagctcaggt gccacttttg       900
     gaaggagact tgaaagttaa gaaccgggag gctcgccttc actatcccgc ctcaattttc       960
     aggccgacag agatccgaca cgtccaagat tgcatccgat gggctctgaa gcatggggtc      1020
     ggcctgactg tcgttggtgg gggccacagt ggtcactgct tatgggataa tgtcgttgca      1080
     gtcgatatgg gcgcctttga ccaagtacac gtcctgcagg ctaggaacgg aggagcagaa      1140
     tccggtttcg attgcacgcc cctagtcgtc gctgaggccg gttgcaaaac gggcgatatt      1200
     attcgcaatg ctatggcaat gggcataaca gtgcccttag gagcccgccc aagcgttggc      1260
     gcggggctat ggctacaagg tggcatcggt catctggcta gaatgtacgg gcttgcgtgt      1320
     gacgccatcg tcggtgccgt gattgtcagc gtcgactcta gccaggtctt ctgcatcggt      1380
     catgtgccaa gccaacacca gccggtcggt gccgttcgcc cgggaaatga aactgatctg      1440
     ttatggggaa taaaaggcgc tgggactaac ttcggcatcg tagtcagcgt gactttcaag      1500
     gcttttccgt ctccgactta ctcagttcga aattggattg cccccctgaa tgacagcctt      1560
     gaggcgcagg tcaaacttag tgaattcgat gaatatgtcg ctagacggct ccctcggaac      1620
     tgttctgcag acgcatatct gtactgggat atcggccagc tgcgcctcgg tgtgaccatg      1680
     ttcgaatcat tcgagactag gcccagttcc gaaaccccca ttccattccc cctacccacg      1740
     tccagtggca caattttggg accagaagac aacttcaagt ttgtggacgg tgttggtttg      1800
     tttgaggccg agatgtacat gtccgggatg catggcggac atggcggcag caggacctcc      1860
     tcgttcaagc gatgtctatt tttaaaagac atcggggcac cggaggtcac caacagcttg      1920
     gtgacggcta ttaagactcg tccttcgcca ctctgctatc tccatctgct tcaaggtggc      1980
     ggagcagttg tcgacgtggc agctgatgca gctgcctttg gctgtcgaga ttgggatttt      2040
     gcctgcgtgg tgactggtgt ctggtcccgc gatcaagatg gaactgaagt tgcccgaact      2100
     gccgtccggt gggtatatag cattgctatg gacttgttac ccttgagtag cggcgtttat      2160
     ggtgcagatc tcgggccgga ccctagggac gccgcattgg cggtcgaggc ttttggacca      2220
     aatcggccgc ggctcgcccg tctcaagcag agctcagatc cgcgcaatgt gctggcttac      2280
     acctgcccgc tcgagcaagt gccgataaaa ccgaagctca tcattcttgt gacgggcgat      2340
     agctgtgcgg gtaaggacta ttgcgccaat atctgggtgt ctgcgttcct tgaatgcact      2400
     caaaaaagcc tcgtggcgcg cgcagtcagt atcagcgata cgactaagcg agaatacgcg      2460
     gcagctaccg gtgccgatct aaaccgtttg ctttgcgacc gtgcctataa ggagcaacac      2520
     cggccagcgt tgacaacgtt tttccagagt caggtacgac atagacctcg gttgccagag      2580
     gagcattttc taaaagcggt gtacggcgcc gtagatacgg atgtgctgtt gattactggg      2640
     atgagggatg acgcgccggt cgcgacattc tcccatttgg tgccagacag cagactgctt      2700
     gaagtttgcg tcgaagctag caaacccacg cggtgtactc gccgggggtg ccaagacggt      2760
     gatggtgccg accatcatgc ggacaacaac aatagctggt caaaaccaaa gcccttggac      2820
     tatcgcccta gtctcatctt caataatgac ctcaccggaa gcgaggcggc gcaaagattc      2880
     gcggaactca acctgcttcc ttttttccat aaagaccttc agcgactggc cgacatggtc      2940
     cgcccggtat ccaactttcc acgcccgggc gtcgaattcc gtcatgtgct caacatctcc      3000
     caacaacggg gtgggctgac cctgtgcaca tatctgttgc agactcactt tgctggtgca      3060
     tggggcgaag tcgatgtgct ggcatgttgt gaagccggcg gctttgtcta tgcatcggcg      3120
     ctggcgttgc aagtcaatgt acctttggcg ctgatacgcg aagccgggaa actccctaca      3180
     cctaccgttt ctatcttcaa gcccacgtca cacatctcat cttcgacgtc cgacgatcta      3240
     gaaggaagta ggatcgagat ggaaagggat ttgattccca agggtgcctc agtggtggta      3300
     gtagacgatg tgcttgctac aggaaagaca ctttgtgcgg tgctggattt gttgaataaa      3360
     gctaacatct gtgctaagga tgtcagcatc atggtcgtgg ccgagttccc tgtccaccgc      3420
     ggccgggaac tattgcgtca gcgcgggttt ggcggagtca atatccagag ccttttggtt      3480
     ttcggtggcg cttag                                                       3495
//

If you have problems or comments...

PBIL Back to PBIL home page