(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE463

PENCW_16.PE463       Location/Qualifiers
FT   CDS_pept        1043777..1044265
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201849" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824908"
FT                   /orf_name="Pc20g04630"
FT                   /product="Pc20g04630 protein"
FT                   /protein_id="CAP85792.1"
FT                   /db_xref="UniParc:UPI0001831762"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE34"
FT                   /transl_table=1
FT                   /translation="MYRALHGDVSTLLDETELHFEFHEDDDDTGYIKMHDTSIMGRFVC
FT                   RNRACGSGGWSSKKIAVTIRLYPGQKYNARVYHQRCESCTSVSRPKLDQSYAERVVYWI
FT                   KRWNGVQVERPPSSGNSRRPHNRELCEGCRAGHCSQSREDFIPQFERFVDFQSTNIIQ"
     atgtaccgag ctcttcatgg agatgtatcg acgttgttgg atgagacaga gcttcatttt        60
     gaattccacg aggatgatga tgacacggga tacatcaaaa tgcatgacac aagcattatg       120
     ggccgcttcg tgtgccgtaa ccgagcatgc gggtccggcg gatggtcaag taagaagatc       180
     gccgtcacga ttcgcctata cccagggcaa aaatataacg cgagggtata ccaccaacgg       240
     tgcgaaagtt gcacatccgt cagtcgacca aagctggacc aatcgtacgc tgagagagtt       300
     gtctactgga tcaaacgatg gaacggggtg caggtagaga ggcctccatc gtccggcaac       360
     agcagacgtc ctcataaccg tgaactttgt gagggttgca gagctggaca ctgttcccaa       420
     tcaagggagg atttcatacc acaatttgaa aggttcgtcg atttccaatc aactaatatt       480
     attcaataa                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page