(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE465

PENCW_16.PE465       Location/Qualifiers
FT   CDS_pept        join(1046873..1046915,1046951..1047099,1047347..1047367,
FT                   1047421..1047479,1047538..1047616)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949961"
FT                   /orf_name="Pc20g04650"
FT                   /product="Putative uncharacterized protein Pc20g04650 "
FT                   /protein_id="CAP85794.1"
FT                   /db_xref="UniParc:UPI0001831763"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE35"
FT                   /transl_table=1
FT                   /translation="MSSSGYLTAKAVSVNKKCCTPLPYAAEQGSHKTVKFPAEDKKADI
FT                   DSKDYGHAIYSTTIGDRYTILDMHGMFAIPLLVQASYTACISIDSYIVALNSDTAHEAS
FT                   RSLRLSSLRSIR"
     atgtcttcgt ctgggtactt gacagccaag gctgtgtctg tgaataagaa atgctgtact        60
     cccctaccgt acgcagctga gcaggggtcc cataagactg tcaaatttcc tgccgaggat       120
     aaaaaagctg atatcgattc aaaagactac gggcacgcaa tttactccac tacaataggc       180
     gatcggtata caattcttga catgcatggt atgtttgcca ttcctttgtt agtacaggct       240
     tcatatacag cctgcatttc catagattca tatattgtag ccctcaacag tgatacagca       300
     cacgaagcat caagatcact acgcttgtcc agtttgagaa gcatcaggta g                351
//

If you have problems or comments...

PBIL Back to PBIL home page