(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE466

PENCW_16.PE466       Location/Qualifiers
FT   CDS_pept        join(1048023..1048552,1048617..1048694,1048757..1048907)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217817" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129268"
FT                   /orf_name="Pc20g04660"
FT                   /product="Pc20g04660 protein"
FT                   /protein_id="CAP85795.1"
FT                   /db_xref="UniParc:UPI0001831764"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE36"
FT                   /transl_table=1
FT                   /translation="MTSQHSRFVGAELYSISFDAPTPSTWIVIERVNEHEHRKDPDHSA
FT                   VSYASVKYRCKKDGDASKNAFVRIYKQLPHLGTEFGDHATRANQARAWTPPELVAYKTL
FT                   TDKQSKVTPSLLGYKEEKQDSSAIVPAGFLVSFAWEQVPGVQLGDSLGGKVFWGMSDHQ
FT                   RHIIREAFKNKTIPETETIGIHPLFYGPSHLVWDSVSGNLFMVGFRQWIEVKPTPWSEA
FT                   KSYWFDLAKPPKKVNWSEFVKNPDTSNWEF"
     atgacctcgc agcattccag gttcgtgggc gccgagctct atagtatttc cttcgatgcc        60
     cctacgccgt ctacgtggat tgtcatcgag cgcgttaacg aacacgagca ccgaaaggat       120
     cctgaccact ccgctgtctc ctatgcctcc gttaagtacc ggtgtaagaa agacggagat       180
     gctagcaaaa acgcgttcgt taggatctat aagcaactgc cccacctcgg cacagagttt       240
     ggcgatcatg ctacccgcgc gaatcaagct agggcgtgga ctccgcccga gctagtagca       300
     tacaagactc ttaccgataa gcagtcgaaa gtcaccccca gcctcctagg ctataaggaa       360
     gagaagcaag acagctctgc tattgtaccc gctggcttcc ttgtctcgtt cgcgtgggag       420
     caagtgcctg gtgttcagct aggggatagt cttggcggaa aggtcttctg gggtatgagt       480
     gatcatcaac gccatattat tcgagaagcc tttaagaaca agacaatccc tgagaccgaa       540
     actattggca tccacccttt gttctatggt ccctcgcatt tggtttggga ttccgtctca       600
     ggtaatcttt ttatggtcgg cttccgtcag tggattgagg ttaagccaac accctggagt       660
     gaggcaaagt cctactggtt cgacctagct aaaccaccca aaaaggtcaa ctggtctgaa       720
     tttgttaaaa accctgatac ttctaattgg gagttttag                              759
//

If you have problems or comments...

PBIL Back to PBIL home page