(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE467

PENCW_16.PE467       Location/Qualifiers
FT   CDS_pept        join(complement(1050224..1050307),
FT                   complement(1049925..1050119),complement(1049677..1049730))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949962"
FT                   /orf_name="Pc20g04670"
FT                   /product="Putative uncharacterized protein Pc20g04670 "
FT                   /protein_id="CAP85796.1"
FT                   /db_xref="UniParc:UPI0001831765"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE37"
FT                   /transl_table=1
FT                   /translation="MAVAAGDLMGTQMKRAPEKWWDRTEVSLNQPGLFIEKKSWKCMKS
FT                   DDKEKEQSPMAFPFAALWFFSSLYEAKGTLMIVFLQLLVKNLGATKEADFVAIGVSEAE
FT                   GVCDCR"
     atggcagtgg cggctggtga cttgatggga acacagatga aacgggcccc ggagaaatgg        60
     tgggatagaa ctgaagtctc cttgaaccaa ccagggctct ttattgagaa gaagtcatgg       120
     aagtgcatga agagtgacga taaagagaaa gaacagagtc ctatggcttt tccgtttgct       180
     gctctatggt tcttctcttc tttatatgaa gcaaaaggaa cattgatgat agtttttctt       240
     cagctattag tgaagaacct aggcgctacg aaagaagctg acttcgtagc aataggggtt       300
     tcggaggcag agggagtgtg tgattgtcgg tag                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page