(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE468

PENCW_16.PE468       Location/Qualifiers
FT   CDS_pept        join(complement(1051581..1051824),
FT                   complement(1051478..1051534),complement(1051149..1051429),
FT                   complement(1050636..1050980))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978100"
FT                   /orf_name="Pc20g04680"
FT                   /product="Putative uncharacterized protein Pc20g04680 "
FT                   /protein_id="CAP85797.1"
FT                   /db_xref="UniParc:UPI0001831766"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE38"
FT                   /transl_table=1
FT                   /translation="MFRTATTLSQAINKPHAARGNISSPQFYQLMHEQDGDDARLPSVR
FT                   LSLLNASEVEHILCLEPAKTNQGLDSFPTIPPPELLLKNLAMIDGALKNEKSAEATMDS
FT                   YSEKEELLEIHREPKWSFGPVRYKDQAVKLSGYPSYALWYGDEDEAALKVIVTQSKRLK
FT                   RYDKGIPEVLGYIGEYNVPLLVMQCLLTDLVFVTATLDSEVDLEKVFSLLVHILKEALI
FT                   VQSTQPKEPSMQSNQGEGSAEPLVPAGSSLRRKVAKKTQYKKLKAAVALDEDLDYYDID
FT                   ERDLEAEFPADETSEDEYCEDDYAEDE"
     atgtttcgta cggcgacaac gttgagccaa gccataaata aaccccacgc tgctaggggt        60
     aatatttcat ctccgcagtt ttaccaactg atgcacgagc aagatggtga tgatgcgaga       120
     ctcccttccg ttcgtctatc attgttaaat gcctctgaag tggaacacat actgtgcctc       180
     gaaccggcta agaccaacca gggactggat tcctttccta caatcccccc acccgagttg       240
     cttctcaaaa acctcgcaat gatcgacggt gctttgaaga acgaaaaaag cgctgaagct       300
     acaatggact cgtattctga aaaggaagaa cttctggaga tccaccgtga gcctaaatgg       360
     tcattcggac ccgtccgata caaggaccag gccgttaagc tatcaggata cccatcttac       420
     gccctatggt acggagacga agacgaagcc gctttaaaag ttattgtgac tcagagtaag       480
     aggcttaagc ggtatgataa gggaatcccg gaagtgctag gatatatagg tgagtataat       540
     gtgccactac tggtgatgca gtgcttattg actgatttgg tctttgtcac cgcaacactg       600
     gactctgagg tggacctaga aaaggtgttc agtctattgg ttcatatctt gaaagaagca       660
     ttgatcgtcc aatcgaccca accgaaagag ccatccatgc aatctaacca aggtgaagga       720
     tctgccgagc ccctcgtccc cgccgggtct tctcttagac gaaaggttgc caagaagaca       780
     caatataaaa agctgaaagc ggcggttgct ttggatgagg acctcgatta ttatgatata       840
     gatgagaggg acctcgaagc cgaatttccc gcggacgaga cctctgaaga cgagtattgc       900
     gaagatgatt atgccgaaga tgagtaa                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page