(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE469

PENCW_16.PE469       Location/Qualifiers
FT   CDS_pept        join(1052849..1052878,1053110..1054150)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000201478" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824909"
FT                   /orf_name="Pc20g04690"
FT                   /product="Pc20g04690 protein"
FT                   /protein_id="CAP85798.1"
FT                   /db_xref="UniParc:UPI0001831767"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE39"
FT                   /transl_table=1
FT                   /translation="MLRPRCCSAPFSTLLLDPPPATPAVTDGFPACFRIRSNRVMLPAN
FT                   SIDEFISSELSLRRLEVLERHLWFAGEERSAWPLHHHILVGRKILITEQMDLHLLWAND
FT                   GRLFIKPLSRFLLNPEFWSKKLSCEEPTKCKDHRPTPNTSGSPRTTNSTEPLCDRRSLR
FT                   SCAMGFLYTYACLISYESDFRIANENNLLPCRSNGSTFSWEDWKKFVSEILAHYNKDDI
FT                   HPRFHRAELRLARLNTIHRFTQLPLLEPYFRDWRNFGSVFRDNLTWLASATVFVALVLT
FT                   AMQVGLATDQLKGSKSFMAASYGFTVFAILGPLCAFGLIILGVLHHLLKELPWLLRGEP
FT                   TPLKSPPVSARSMSQV"
     atgctgagac ctcgctgctg ctcagctccc ttttcgaccc tacttttgga ccctccacca        60
     gctacgccag cagtaaccga cggctttcca gcctgctttc gcatccgttc taacagagtc       120
     atgcttcccg ccaattctat agatgaattc atctctagtg aactatccct taggaggcta       180
     gaagttcttg agcggcattt atggtttgct ggagaagaac ggtcggcatg gccccttcac       240
     caccacattc tggtgggaag aaaaatcttg attacagagc agatggatct ccacctgctg       300
     tgggcaaatg atgggagact tttcatcaag cccttgtcgc gatttttgct taatccagaa       360
     ttttggagca aaaagctgag ttgcgaagaa ccgactaaat gcaaggatca ccggccgact       420
     ccaaacacgt ctggatctcc acggactaca aattcaacgg agccgttatg cgataggaga       480
     agtctccgca gttgcgctat ggggttcctc tatacatacg cgtgccttat atcctacgaa       540
     agtgactttc gcatcgctaa tgagaacaat cttctgccct gccgttccaa tggttcaact       600
     ttcagctggg aggactggaa gaaattcgtt agcgagatcc ttgcccatta caacaaagat       660
     gacattcacc ctcgctttca ccgcgctgag cttcgtctag ccagactcaa caccatccat       720
     cgcttcactc agcttccgct tctcgagccc tactttcgtg actggcgaaa cttcgggagt       780
     gtgttccgcg ataacctcac ctggctagcc agcgcaactg tcttcgttgc cttggttttg       840
     acagcaatgc aggttggcct tgccacagat cagctaaagg ggagcaagag cttcatggct       900
     gcctcatatg gatttaccgt ctttgccatt ctgggtccac tctgcgcctt cggattgatt       960
     atcctaggtg tgctccatca cttgttgaag gaattgccgt ggctgctccg tggagaacca      1020
     acccccttaa agagtcctcc cgtgagcgcc cgctcaatgt cacaggtttg a               1071
//

If you have problems or comments...

PBIL Back to PBIL home page