(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE47

PENCW_16.PE47        Location/Qualifiers
FT   CDS_pept        join(105210..107396,107458..107736)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671391"
FT                   /orf_name="Pc20g00470"
FT                   /product="Pc20g00470 protein"
FT                   /protein_id="CAP85376.1"
FT                   /db_xref="InterPro:IPR022771"
FT                   /db_xref="UniParc:UPI0001831AB2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFE3"
FT                   /transl_table=1
FT                   /translation="MDNSHPRNRRLVTYGSAAKSQPPSNTEKTVRSSATRTTSKEMPLP
FT                   SSSRPSRPVYTRLQRDKNGDKQLSGPAKTTTARGVTQPKPITEANVYDFPSSDDEQMSM
FT                   IQRKRRRYSPNGNKAVPATKRSAKPSETGNGVHNVSPPMGKRGSDGRRPLAKKLEADER
FT                   TSSVASTSYSRPGRSVRNQTKLPTVENEMGVSTAEGLGDGESIRKSSPDINQGYATKAN
FT                   VTPGRRRLIDSLGITQSPVETSPAVETPLESPADSQPPPDPTTPDRASPSAAVNECPAE
FT                   SHVQDSPASVPSHLRGSRVTYARQRSFLDDLIMSEDLSTHNASSGLRHRSQSVQRQLNY
FT                   EATSSARLIVPNEDTNDDGSVRSIHELRQAGGNARYRGAVESIFEDIEDSQNSLTGRCN
FT                   AFLQLCGKLLDTGLKRRFVECNFDKRLVDCLSMDLQVVPTILAFCAYALGSSDGHMSYV
FT                   LATSAWPKLQEASPALLGMHDDIPVAARAQASGLSRPLQKTIQNTIPQIAAMLFPDTAL
FT                   SKLSPCILALYCLRSTMSTTQTKGENPSLSKSLLKPLVQALVLEGQRCASLGKIHPESS
FT                   EILCMGFSILESSTALAESFTKDHWDILDPLSELHSLLCLESGTAGQIQLLYIRLILNV
FT                   TNSNPSLCDRFATPEMVGGLVRIVSAKFGDLTEDALGQANSSLDSVILALGALINLTEQ
FT                   SEASRSIFLHSADSSKLFLDQLLHLFMTRVDSISTAHSVLEVHHNVAVGYLAVLLLTLS
FT                   LDPATRSKIKSSLAPNGLTTVISTVDEFLQYHQKIEQEISTSPTQGQPASGFLSRLQEL
FT                   ITRIRLAEQ"
     atggacaact cacaccctcg gaatcgacga ctcgtaacct atggctctgc tgctaaaagt        60
     caacctccgt cgaatacaga aaagactgtg cgctcatctg ctactagaac aacttctaaa       120
     gaaatgcctt tgccaagctc gtcacgtccc tcacgaccag tctacaccag gttacagcgc       180
     gacaagaatg gagataaaca actatctgga ccggcgaaaa caactacagc tcgaggagtt       240
     acacaaccaa aacccatcac ggaggctaat gtgtatgact ttccctcttc agacgatgaa       300
     cagatgtcca tgatccagag aaagcgaagg cgatatagcc ctaatggaaa caaggcagtt       360
     cctgcgacta agcgatcagc gaagccaagc gagacaggga atggagtcca caacgtgtca       420
     ccgccaatgg ggaagagggg ttccgatggc cggagaccat tggccaaaaa gctagaagcc       480
     gatgagcgaa caagctccgt ggcgtcgaca tcatattcaa ggcctgggag gtctgtgcgg       540
     aaccagacta agctgcctac tgtcgagaac gaaatggggg tttcaaccgc ggaaggcctc       600
     ggggatggag agtccatacg aaagagctcg ccggacatca accagggcta tgccacgaaa       660
     gcgaacgtca cccccggtcg aaggagactg attgactcgc tcgggatcac gcaaagccca       720
     gttgaaacat ctccggcggt tgaaacacca ctggagagtc ccgctgatag ccagccaccc       780
     ccggatccaa ccactcctga tcgagcatcg ccaagtgcgg ctgtgaatga gtgtcctgcc       840
     gaaagtcacg ttcaagactc tcctgcctca gtaccatctc atttacgagg ttcccgtgtc       900
     acctatgcac gccagcgttc ttttttggat gacttgatta tgtcagagga cctttcgacg       960
     cacaatgctt cctcgggcct gagacaccgc tctcaatctg tccaacgtca gttgaattat      1020
     gaggctactt ccagcgctcg tttaattgtg ccaaatgagg ataccaacga cgatggctct      1080
     gtccgaagta ttcatgaact cagacaagct ggaggaaacg ctcgttaccg aggtgctgtc      1140
     gaatctatct ttgaggacat cgaagattcg caaaactcgt tgacgggtcg atgcaatgcc      1200
     ttcctccagc tgtgtggtaa gcttctggat actggactca aacggcggtt tgtcgaatgc      1260
     aattttgaca aaagactcgt ggattgtcta tctatggacc ttcaggtggt tcctaccatc      1320
     ttggctttct gtgcctacgc actgggatca tcggatggac atatgtccta tgttcttgca      1380
     acttccgcgt ggcctaagct tcaagaggca tcacccgctt tactgggcat gcacgatgat      1440
     ataccagtgg ccgcaagagc tcaagccagc ggcctttctc gacccttgca aaagacaatt      1500
     cagaacacta ttccacagat agctgctatg ctgtttcctg atactgcatt gtccaaactg      1560
     tccccatgca tcctggcgtt gtattgcctg aggtcaacga tgtccacaac acaaaccaaa      1620
     ggcgagaatc ctagcctctc caagtctctt ctgaaaccgt tggttcaagc gctcgtgtta      1680
     gaaggccaac gttgtgcttc gttggggaaa atacacccgg agagctctga gattctttgc      1740
     atgggctttt caatattgga atcttctact gcattggctg agtcgtttac gaaagatcat      1800
     tgggatatcc ttgacccgct ctctgagctt cacagccttc tctgtctaga gtcaggcact      1860
     gcgggccaaa tacagctcct ctacattcga cttatcttga atgtcaccaa cagcaacccc      1920
     tccctctgcg atagattcgc aaccccagag atggttggcg gactggtccg cattgtctcc      1980
     gcaaaattcg gtgatttgac cgaagatgcg cttggacaag caaatagttc tctggacagc      2040
     gtgatattgg cgctcggtgc acttatcaat ctgactgaac agagtgaagc atcaagatcg      2100
     atttttcttc actctgctga ttcctcaaag cttttccttg atcagctctt gcatttattc      2160
     atgactcgtg ttgattccat ctccacggct cattcggtct tggaagtaca ccacaatgtt      2220
     gctgtgggat atttggctgt ccttttacta acactcagtt tggatcctgc gactcggtcc      2280
     aaaatcaaga gctcactcgc tcccaacgga ttaacaacgg tgatatctac cgttgatgaa      2340
     ttcttgcaat accatcagaa gattgaacaa gaaatctcca cttctccaac ccagggacaa      2400
     ccagcgagtg ggtttctgtc cagattacaa gaacttatca ctcggattcg actggcagag      2460
     caataa                                                                 2466
//

If you have problems or comments...

PBIL Back to PBIL home page