(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE470

PENCW_16.PE470       Location/Qualifiers
FT   CDS_pept        join(1054706..1055500,1055550..1058976,1059010..1059254)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201479" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672210"
FT                   /orf_name="Pc20g04700"
FT                   /product="Pc20g04700 protein"
FT                   /function="binding"
FT                   /protein_id="CAP85799.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR007111"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0001831768"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE40"
FT                   /transl_table=1
FT                   /translation="MPTFNSSGFKSSNPDEPLETSQNVRGVKLDQVYPPPESTAETDID
FT                   IIAIHGLDTKSPDTWTWKKDGISVNWLKDSNMLPEKVPMARIFTCDWPSDLFERRDFVQ
FT                   KTIEEFARLMLAGIKGRRSSMNQSQLQGSERPIIFVASCLGGVILMKMLVMATHEYDCV
FT                   KKATRGFVFLATPFRGTSFEEVVFWAKPGLITRGLFRGKKPSNLMNYVMPARDLEILVG
FT                   QFSTVCEDENLTNDLFTFYETGVTSLPRKAIPYIPKALAKLKPLVNSSSATLDFAKHPL
FT                   PIEQPHVLVNKFQGPGDPGYCHVSDAVQGLVCKARSGRPIERAKAWIRDNRYSLRKLEI
FT                   ERLSGKKLPMDQCYINLAIVEQQRSISQSDKTKTAFEYSPFSLQTRLNLMAPGEETEAN
FT                   LPNIFEPREKRNGQRMTPNRILIRGRAGVGKTTLCKKIVYEFTYGKMWHSLFEHVLWVP
FT                   LRKLKLKERKKIAGYNFGHMFCHEFFSQIPSTAEMEELSNALWRTLGDGDNTKTLFLLD
FT                   GLDEVSQDVNGDMRDFLEELLNQPNVIVTSRPNAISTAFLRQPFDLELETIGFYPKQVT
FT                   SYIETAFTEIETGQMDSQAVNNIESFLETRQLMQDLVRIPIQLDALCYTWHEFQRKTDA
FT                   VPETMTGVYTAMELSLWKKDVVNLGRRTEVEIEFASDGTIRKLVKLEAEALQLVAFTGM
FT                   YNDIIDFAPQHRDTIFEHVDSNCLDDQWLGRVSFLRTSDSSSDNRNRDYHFLHLTFQEY
FT                   FAALHFVRKWKADEDLEFSNLATGEKIRISPAEFLGINKYSARYDIVWRFVAGLLDLNG
FT                   GPKEPERFFRALDQKPLDLLGIAHQRIVMNCLSEIQSEFSLRSKIESHLSKWLAFQCKT
FT                   ILEQDQRLLKESIITLASEIEFPENALTGLLKENDEKVMTVALLSVKKRHQIQSQIMEI
FT                   ATSLLQRTKSSDVAISMFTFLRRQRENLSEESLDLMVLHLQNPDRGVRLSAADTIRGFA
FT                   LPDRTCRKVIETGVIQRRRDNRFEGFEGMALSDQSMSKETLTDLIASLESPDKNIRRVA
FT                   SDVLSHRSDFLPEEVTSIMAKIEHQDSDVRWCSFNALRGQSHSSGMFTGLLWPEVNGSS
FT                   KKISNCALEVLYQLSNSSEDLLERIIVELLPHRSCWHILKSYCNRSRLSKKALNALETH
FT                   LGSPDYGLRCAAINILAGQPDLSFSILNRIVEQLEDGTSKVRTAAVYAIRRQPRLPIET
FT                   ALEIARRFKNDKLPSKIVLQIFEHQSNSPKEVLVQIARCIEDQDVSIRSAAIRALSGQS
FT                   NLSDLPEIHEKVIAYIEDSDAEVREAAIQAVSVGRPSMSDTTFDTIATRMDDTNEKVRL
FT                   AVVQVLGQKETLCFDIVNTLADLMNDTDEKVRWATLKVLADQSTWPGAIRHKIASKVYC
FT                   PLAFRVKREEFHLNFLLGGLAKQILRLLLLRTSRMHLAWYIHNDMSYVERSDGSKAPLP
FT                   CAGADIELGMMSAREEAGIPPVAVLYS"
     atgccgacat tcaacagctc tggattcaaa agttccaacc ctgatgagcc ccttgagacc        60
     tcacaaaatg tgagaggagt caaactcgat caagtatatc ctcctcctga gagtaccgca       120
     gaaaccgaca tcgacataat tgccattcat gggctggaca cgaagtcgcc cgacacatgg       180
     acatggaaaa aagatgggat cagtgtcaac tggctcaaag actcgaatat gcttcctgag       240
     aaagtcccaa tggcacggat tttcacatgt gattggccca gcgacctctt tgaacggcga       300
     gattttgttc aaaagacaat agaggagttc gctcgcctta tgctcgctgg tattaaaggt       360
     cggcgctcgt ccatgaatca atcgcagttg cagggatcgg aaaggcccat tatctttgtg       420
     gcatcgtgtc ttggaggggt aattctgatg aaaatgcttg tcatggctac ccatgagtat       480
     gattgcgtga aaaaggcgac aagaggtttt gttttccttg caaccccatt tcgtggcacg       540
     tcgttcgagg aagtggtatt ttgggctaag ccgggcttga taacccgggg tttgtttcga       600
     ggcaaaaagc catcaaacct catgaattac gtgatgccag cccgtgacct cgaaatcctt       660
     gtcggccagt tcagcactgt ctgtgaggac gaaaacctca ctaatgactt attcactttc       720
     tacgaaactg gcgtgacgag ccttccccga aaggcaattc cctacattcc caaggctctg       780
     gcaaaattaa aaccactggt caattcgtca tcggcgacgc ttgactttgc taagcatcca       840
     ttgcctatcg agcaaccaca cgttttagtg aacaagtttc aagggcctgg tgatcctggc       900
     tactgccatg tctctgacgc agtgcaagga cttgtttgca aagctcgcag tggtcgtccg       960
     atcgagagag caaaggcatg gattcgagat aatcgctatt ctctacgaaa gctcgagatc      1020
     gaaaggcttt caggcaagaa actgccaatg gatcaatgct acataaatct ggctattgtt      1080
     gagcaacaaa gaagcataag ccagtcggat aagaccaaaa cggcatttga atactcgccc      1140
     ttctcactcc aaactcgatt gaacctcatg gctccgggcg aggagaccga agccaatcta      1200
     ccaaacattt tcgagccccg cgagaaacgc aatggccaga gaatgacacc aaatcggatt      1260
     ctgatccgcg gccgagcagg ggtaggcaaa acaactcttt gcaagaagat agtctatgaa      1320
     tttacatatg gcaaaatgtg gcatagtctt tttgaacatg tgctatgggt accgttacgc      1380
     aagctgaagc tcaaagagag gaaaaagatt gccggataca atttcggaca tatgttctgt      1440
     cacgagtttt tctctcagat cccaagcacc gcagagatgg aggagctatc taatgcttta      1500
     tggagaacgt tgggagacgg tgataacact aagaccttgt ttctcttgga tggcctggat      1560
     gaggtctctc aggacgtaaa cggggatatg cgggacttcc ttgaagagct cttgaatcag      1620
     ccaaatgtca ttgtcacatc ccgcccgaac gccatatcca cagccttctt acggcaacct      1680
     tttgatcttg aattggagac catcgggttt tacccgaagc aagtgacttc atacattgag      1740
     acggccttca ccgaaattga aacagggcag atggattccc aagcagtgaa caacattgaa      1800
     tccttcctcg aaacccgcca gctcatgcaa gaccttgtgc gaattcccat tcaactggat      1860
     gccctttgct acacttggca cgaattccaa agaaaaacag atgctgtccc agaaaccatg      1920
     acaggggttt atacagccat ggagctaagc ctatggaaaa aggatgtcgt gaatcttgga      1980
     aggagaacgg aggtggaaat tgaatttgct tcggacggaa cgatcaggaa acttgtcaaa      2040
     cttgaagcag aagctctcca gctggttgcc ttcactggaa tgtacaacga catcatcgac      2100
     tttgcgccac agcatcgaga cactatattc gaacatgtcg attctaactg cttggacgat      2160
     caatggcttg gaagggtttc cttcctccga acatcagatt catcaagtga caaccgcaac      2220
     cgagactacc acttccttca cttgaccttc caagagtact ttgccgctct acattttgtg      2280
     cgcaaatgga aagccgacga agacctggaa ttctccaacc tggctaccgg ggagaagatc      2340
     cgcatttcac cagccgagtt cctggggata aacaaataca gcgctcgcta tgatatagta      2400
     tggcgctttg ttgccggact acttgacttg aatggtggac caaaagagcc agagagattc      2460
     ttcagggccc tagatcagaa accacttgat ctcttgggta ttgcccacca gcggattgtc      2520
     atgaattgct tgagcgagat tcaatctgaa ttttcacttc gaagcaaaat tgaaagccat      2580
     ttatcaaaat ggctggcatt tcaatgcaaa acgattctag aacaggacca aaggttactt      2640
     aaagagtcaa taataacctt ggcaagcgag attgaatttc ccgagaatgc tctaaccggt      2700
     ctcctaaaag agaatgatga gaaagttatg acagttgcct tactttcggt gaaaaagcgt      2760
     catcagatcc aatcccaaat catggaaatt gcgacttcac ttcttcaaag gacgaaatcc      2820
     agtgacgtgg caatttcaat gtttacgttt ttaagacgac aaagagagaa cttgtcagaa      2880
     gagagtctcg atcttatggt cttgcatctt cagaacccag atcgaggtgt aaggttgtct      2940
     gctgctgaca ccattcgcgg attcgctttg ccagatagaa cctgccgcaa agttatagag      3000
     acgggcgtta tacagaggag gagggataac cgctttgaag gcttcgaagg catggcccta      3060
     agtgaccagt caatgtcaaa agaaacattg actgacctta tcgcaagtct cgaaagtccc      3120
     gacaagaata tcagaagggt tgctagcgac gttttgagcc accgatctga ctttctccca      3180
     gaagaggtca cctcaataat ggcgaagatt gagcatcagg acagcgacgt taggtggtgc      3240
     tccttcaacg ctctacgcgg gcagtctcac tcgtcgggaa tgttcactgg attgctgtgg      3300
     cctgaagtga acggaagctc aaagaaaatt tcaaactgtg cccttgaagt tttataccag      3360
     ctttcgaatt cttcagagga tttgctcgaa cggattatcg tggagcttct gcctcatcgc      3420
     agctgttggc acatactcaa aagctattgc aaccggtcaa ggctgtccaa aaaagccctt      3480
     aacgccctag aaacacatct agggtctcca gactacgggc taagatgcgc agctatcaac      3540
     attctagctg gacaacccga cctgtcattt tcaattctga acaggatagt ggagcaactt      3600
     gaggatggca ccagtaaggt taggacggcg gccgtctatg ccatacgtcg ccagccgcgc      3660
     ttaccaattg agaccgctct cgagatagcg aggagattta agaacgacaa gcttcctagc      3720
     aaaattgttc tgcaaatttt cgaacaccag tccaattcac caaaggaagt ccttgtccag      3780
     attgcgcgtt gtattgagga tcaagacgtt tccatcagaa gtgccgcgat ccgcgccctg      3840
     agtgggcagt caaatttgtc ggacctgcca gaaatccatg aaaaagtgat tgcctacatt      3900
     gaagattcag atgcagaagt tagagaagca gccatccaag cagtcagtgt tggtcgccca      3960
     tcgatgtcag acacaacctt tgacacgata gctacaagaa tggatgacac caacgaaaag      4020
     gtcaggctag ctgttgttca agttctcggc cagaaagaaa cgctatgctt tgatatcgtc      4080
     aatacgctgg cagacctgat gaatgatacg gacgaaaaag tccgatgggc taccctcaaa      4140
     gttcttgccg atcagtcaac ttggcctggg gcgattcgtc acaaaatagc gtcaaaggtc      4200
     tattgtccgc tggccttcag agtgaagcgg gaagagttcc atttgaattt cctcctcggc      4260
     ggccttgcaa aacaaatttt gcggcttctg ctgctgcgaa cctccaggat gcacctagca      4320
     tggtatatcc acaatgacat gtcttatgtt gagagaagcg atggttccaa agcaccatta      4380
     ccgtgtgctg gagccgatat agagctaggg atgatgtcag ctcgggaaga agctgggatt      4440
     ccgcctgtgg cggtattgta ttcttga                                          4467
//

If you have problems or comments...

PBIL Back to PBIL home page