(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE471

PENCW_16.PE471       Location/Qualifiers
FT   CDS_pept        join(1062362..1062527,1062593..1063293,1063357..1063629)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000044165" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672211"
FT                   /orf_name="Pc20g04710"
FT                   /product="Pc20g04710 protein"
FT                   /function="asparaginase activity"
FT                   /biological_process="asparagine metabolic process "
FT                   /protein_id="CAP85800.1"
FT                   /db_xref="GO:0004067"
FT                   /db_xref="GO:0006528"
FT                   /db_xref="InterPro:IPR004550"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="UniParc:UPI0001831769"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE41"
FT                   /transl_table=1
FT                   /translation="MGFSLQALTVSALAITSYASPLIHSRATNTSYTNSNGLTFNHFNG
FT                   SLPNVTILATGGTIAGTSDDKTATAGYESGALGINTLLSKIPEIFNVANIAAVQAHNVN
FT                   SGDISSSLLLNLTHTLQATVCDDPTMSGAVITHGTDTLEESAFFIDATVNCGKPIVFVG
FT                   SMRPATAISADGPMNLVQGVTVAADNDSRDRGALVVLNDRIVSALFATKTHANTMDTFK
FT                   AYEQGNLGFIVSNKPYFYYPAVQANVKHVVDVSNVDSVPRVDILYAYEDMQVDSLYSAM
FT                   KNGAKGIVVAGEGAGGVATDFGSAINDIVKKHNIPVVLSHRTVNGEVPTADFTGEDAQT
FT                   KIASGLFNPQQARILLGLLLAEKKGLKEIREVFLKATVA"
     atgggtttct ctcttcaggc cctcacggtt tcagccctag ctatcacaag ctatgcctcc        60
     cctttgatcc actcgcgggc aacaaacaca tcctatacaa actccaacgg cttgacattc       120
     aatcacttca atggttctct tcctaacgtg accatcctag caaccggcgg caccatcgcc       180
     ggcacaagcg acgacaaaac cgcaacagca ggctacgaat ccggcgccct aggaatcaac       240
     actctcctct ccaaaatccc agagatcttc aatgtcgcca acatcgccgc cgtgcaggct       300
     cacaacgtca acagcggcga catctcctca tcccttctcc taaacctgac ccacaccctc       360
     caggcaacag tctgcgatga tcccaccatg tccggagccg tgatcacgca cggaacagac       420
     accctcgagg agtccgcgtt cttcatcgac gcaacagtaa actgcggcaa gccaatcgtg       480
     ttcgtcggct cgatgcggcc cgctaccgct atctcagcgg acggacccat gaacctcgtc       540
     cagggagtga ccgttgccgc agacaatgac tccagagacc gtggggcatt ggttgttctg       600
     aatgaccgta ttgtatctgc tcttttcgct accaagaccc atgcgaatac tatggatacc       660
     ttcaaggcat atgagcaggg aaatcttgga ttcattgtgt cgaacaaacc ctacttctat       720
     tacccggctg tgcaggcaaa tgttaagcac gtggttgatg tgtctaatgt ggattctgtt       780
     cctcgtgtgg atatcctgta tgcctatgag gatatgcagg tcgattcgct gtacagcgct       840
     atgaagaacg gtgctaaggg tattgtggtt gctggcgagg gtgcaggtgg tgttgccaca       900
     gatttcggtt ctgcgatcaa tgacattgtt aagaagcata acatccccgt cgtgttgtcg       960
     caccgtactg tgaacggtga agtccccact gctgatttca ccggcgagga cgcgcagacc      1020
     aagattgcta gtggattgtt caatccccag caggccagaa ttctgcttgg gttgttgttg      1080
     gctgaaaaga agggccttaa ggagatccgg gaggtgttct tgaaggctac cgttgcttaa      1140
//

If you have problems or comments...

PBIL Back to PBIL home page