(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE472

PENCW_16.PE472       Location/Qualifiers
FT   CDS_pept        join(complement(1065671..1065806),
FT                   complement(1065497..1065576),complement(1064925..1065407),
FT                   complement(1064020..1064859))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000276708" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978101"
FT                   /orf_name="Pc20g04720"
FT                   /product="Pc20g04720 protein"
FT                   /function="dihydrolipoyl dehydrogenase activity "
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="cell redox homeostasis"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP85801.1"
FT                   /db_xref="GO:0004148"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="UniParc:UPI000183176A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE42"
FT                   /transl_table=1
FT                   /translation="MFRAVLPRATPRSALRHAGPRAIPNNFATSMIFIGQSKRGFASEA
FT                   GDHDLVIIGGGVAGYVAAIKAGQEGLKTACIEKRGKLGGTCLNVGCIPSKSLLNNSHLY
FT                   HQVLHDTKKRGIEVGDVKLNLTQMMKAKDTSVDGLTKGIEFLLKKNGVDYVKGAGSFVD
FT                   ANTIKVALNEGGEQTLRAKNIIIATGSEATGFPGLNIDEKRIITSTGALALTEVPKKMT
FT                   VIGGGIIGLEMASVWSRLGAEVTVVEFLGQIGGPGMDAEIAKQAQKILGKQGIKFKTGT
FT                   KVVSGDDSGSTISLNIEAAKGGKEEVLDADVVLVAIGRRPYTEGLNLEQVGIEKDDRGR
FT                   LVIDQEYRTKLPHIRVVGDCTFGPMLAHKAEEEAVAAIEYIKTGYGHVNYAAIPSVMYT
FT                   HPEVAWVGQNEAEIKASGVKYRVGSFPFSANSRAKTNLDTEGVVKFIADAETDRVLGVH
FT                   IIGPGAGEMIAEATLAIEYGASSEDIARTCHAHPTLSEAFKEAAMATYSKPIHF"
     atgttccgcg ctgtcttgcc ccgggctacg ccccggtctg ccctccgtca tgccggcccc        60
     agggctattc ccaacaattt tgcaacttcc atgatcttca ttggccagtc aaaacgtggt       120
     ttcgcatctg aagcaggtga tcacgacctg gtcatcatcg gtggtggtgt cgccggttac       180
     gttgctgcta tcaaggccgg tcaagagggt ctcaagaccg catgtatcga gaagcgcgga       240
     aagctcggcg gtacctgctt gaacgtcggc tgtatccctt ccaagtctct cctcaacaac       300
     tcccatctct accaccaggt tcttcacgac accaagaagc gtggtatcga ggtcggcgat       360
     gtcaagctca accttaccca gatgatgaag gccaaggata catctgttga cggtctgacc       420
     aagggtattg agttcctgct caagaagaac ggcgtcgact acgtcaaggg tgccggttct       480
     tttgttgatg ccaacaccat taaggtcgcg ctcaacgagg gtggtgagca gaccctgcgc       540
     gctaagaaca tcatcattgc caccggctcc gaagctaccg gcttccctgg cttgaacatt       600
     gacgagaagc gcatcatcac cagcaccggt gctctggctc tcactgaggt ccccaagaag       660
     atgaccgtca tcggtggtgg catcatcggt cttgagatgg cttccgtctg gtcccgtctc       720
     ggtgctgagg tcaccgtcgt tgagttcctc ggccagatcg gtggccccgg catggacgcc       780
     gagatcgcca agcaggccca gaagatcctg ggtaagcagg gtatcaagtt caagaccggc       840
     accaaggtcg tttccggtga cgacagcggc tctaccatct cccttaacat tgaggccgcc       900
     aagggtggca aggaggaggt tctggatgcc gacgttgtcc tggtcgccat tggccgtcgc       960
     ccctacaccg agggcctgaa cttggagcag gttggaatcg agaaggacga ccgtggccgc      1020
     cttgtgatcg accaggagta ccgcaccaag ctcccccaca tccgtgtcgt cggtgactgc      1080
     accttcggtc ccatgctggc ccacaaggcc gaggaggagg ccgttgccgc tatcgaatac      1140
     atcaagaccg gttacggcca cgtcaactac gctgccattc ccagcgttat gtacacccac      1200
     cccgaggtcg cttgggttgg ccagaacgag gccgagatca aggcgtccgg tgtcaagtac      1260
     cgtgtcggta gcttcccctt cagcgccaac tcccgcgcca agaccaacct cgacaccgag      1320
     ggtgttgtta agttcatcgc cgatgccgag accgaccgcg ttctcggtgt ccacatcatc      1380
     ggccccggcg ctggtgagat gattgctgag gccaccctcg ccattgagta cggtgcctcc      1440
     tctgaggaca ttgcccgcac ctgccacgcc caccccaccc tctccgaggc cttcaaggag      1500
     gctgccatgg ccacctactc caagcccatt cacttctaa                             1539
//

If you have problems or comments...

PBIL Back to PBIL home page