(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE473

PENCW_16.PE473       Location/Qualifiers
FT   CDS_pept        join(complement(1068248..1068496),
FT                   complement(1066897..1068177))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000167003" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129269"
FT                   /orf_name="Pc20g04730"
FT                   /product="Pc20g04730 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP85802.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000183176B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE43"
FT                   /transl_table=1
FT                   /translation="MAEERGNEVDTKTPDLPSQHGDTRQQGYSQFTVAQKRAIVAMGSL
FT                   ASFFSPLSSSIYLPALTSIANSLHISISQVNLTVTTYLIMQGVAPMLIAGFSDTAGRRP
FT                   AYTICFAIYLAANLGLGLQNSYAALLVLRCLQSAGSSGTVALANGLVGDMITSAERGSY
FT                   IAFASVGSMLGPSLSPIIGGLISQYTDWHWIFWFLLIFGGVFFLVLGLFLPETCRKVVG
FT                   DGSIPPPPLNNSVADIIRHRTRKQKGLVPDPYKEAEVRKNYSLRFPSPVPTMKVLLDLE
FT                   TSVILLTTGLLFAGFYAVMTGASTSFHKIYQFNDLHAALMYLPIGGGGVLSAFTTGRLV
FT                   DWNYRRHAKRAGLTVVKNVRADIRNFNIERARLEVALPLYYISNLAMLTYGWVLGHKVN
FT                   LAAPVILLFIIGWSIIGTSQVLNALMVDLWPGKSAAATAANNLFRCELGAAASAAISPM
FT                   RSAMGEGWAYTTLALIPIAVSPCLWMVALNGIKWRQKRNRKEEEKSSCEQD"
     atggcggaag agcgcggcaa cgaggttgat accaaaacac ccgacctgcc aagccagcat        60
     ggagacacgc gccagcaagg atactctcag ttcactgtgg cccagaagcg ggccattgtt       120
     gccatgggat ccctggccag tttcttctca cccttgtctt cgagcatcta tctgcccgcc       180
     ttgacctcca tcgcgaattc cttgcatatc tccatctccc aggtgaacct gacggtcact       240
     acttatctga tcatgcaggg ggtggcacct atgttgatcg caggcttctc ggatactgca       300
     ggccgccgtc ccgcttacac catttgcttc gcaatctatc ttgctgccaa tctgggactc       360
     ggtctccaaa acagctatgc tgccctcctg gtcctcagat gtctacagag tgcaggtagc       420
     agtggcactg tggccctggc gaacgggttg gtcggagaca tgatcacatc cgcggagcga       480
     ggctcataca tcgccttcgc ctcagtcggg agcatgttag gtccgtcttt gtcaccaatc       540
     attggcggcc ttatcagtca gtacaccgat tggcactgga tcttttggtt tctgctcata       600
     ttcggtggcg tgttcttcct tgtcctcggt ctattcctgc cagagacttg tcgcaaagtc       660
     gtcggtgatg ggtccatccc accgcctcct ttgaataact cggtggcgga tattatccgg       720
     catcgcacgc gcaagcagaa aggtctcgtg cctgacccat acaaggaagc tgaggtacgg       780
     aagaactact ccctccggtt cccgtcgccg gtcccgacta tgaaggttct cctggatctc       840
     gagacgtcgg tcatcttact caccacaggc ctgctgtttg ctggtttcta tgctgtcatg       900
     actggtgcat cgacctcctt ccataagatc taccagttca acgaccttca tgctgccctg       960
     atgtacctcc ccatcggcgg aggaggggtt ctctcggcct tcacgactgg ccggctggtc      1020
     gactggaact accgtcgcca tgcgaaacga gccggactca ctgtggtcaa gaacgtgcgt      1080
     gctgatatcc ggaacttcaa cattgagcgt gcgagacttg aagtcgccct tccactctac      1140
     tacatcagta acttagcgat gctgacctac ggctgggtgt tgggtcacaa ggtcaacctt      1200
     gctgctcctg tcattctctt gttcatcatc ggatggtcga tcatcggtac gtcacaggtc      1260
     ctcaatgcct tgatggtgga tctctggccg gggaagtcgg cagctgcgac tgctgcaaac      1320
     aatctattcc ggtgtgagct tggtgccgcg gcgtcagcag cgatcagccc tatgagatct      1380
     gcgatgggcg agggctgggc atacaccacg cttgctttga tcccgattgc tgtttctcct      1440
     tgcttgtgga tggtggcgct taatgggatc aagtggcgac agaaaaggaa tcgaaaggag      1500
     gaggagaagt cgtcatgtga acaggactaa                                       1530
//

If you have problems or comments...

PBIL Back to PBIL home page