(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE476

PENCW_16.PE476       Location/Qualifiers
FT   CDS_pept        join(1073807..1074203,1074258..1074411,1074463..1074937,
FT                   1074992..1075227,1075281..1075371,1075428..1075778)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000167080" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949964"
FT                   /orf_name="Pc20g04760"
FT                   /product="Pc20g04760 protein"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP85805.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831840"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE46"
FT                   /transl_table=1
FT                   /translation="MSDKISSWNVVHKLEKRQLLIGINCVAGLSILFFGYDQGMMAGVN
FT                   NSKDYIDLMKFGYTKVVDGEVTPVVTNSLLQGGIVSVYYLGTLFGALLGGWLGDWTGRI
FT                   KTIAAGSLWAILGAALQCSAQNHNWMICARFVNGIGTGILNAIVPVWATETAEHTSRGQ
FT                   FIAIEFTLNIFGVVLAYWLEFGLSFIDNGESAFRWRFPIAFQIVFLIVLFAVVWFFPES
FT                   PRWLVKVGREEEARYILQRLRGSSGEDLLRAEAEFQDILSIAELERTVNHGDSYLSMLV
FT                   GYKSGDLHIGRRVQLVIWLQIMQEWVGIAGVTVYAPTIFGIAGFDSMKSQWISGLNNIF
FT                   YMFATLVCVFTLDRIGRRWTLYWGATVQGIAMFLGGGFSRLAIDSKAAGDMAKASSYGA
FT                   AAASMIFIFTSAFGASWLTVPWVYPAEIFPLAVRARGNAFGVVGWSIGNGWLTLLCPVM
FT                   FSAIGEKTLYVFAASNVIAIPMVWALYPESNQRTLEDMDLLFAAKTPWTWDAEKTFARL
FT                   KAENPGMVQSLGPKGSLVDPETGKPLSAAAAVAASKAGDNAVGAEHVDHA"
     atgagtgaca aaatctcctc gtggaatgtc gtccacaagc tggagaagcg ccagcttctc        60
     atcggaatca actgcgtggc tggactgtct attttgttct tcggttatga ccaaggaatg       120
     atggctggtg tcaacaactc aaaggattat attgatctca tgaaattcgg gtatacgaag       180
     gtggtggacg gcgaggtaac cccagtggtc acaaattctc tgctgcaagg tgggattgtg       240
     tcggtctact acctgggaac gcttttcggc gcattactcg gtggctggct tggagactgg       300
     acgggaagaa tcaaaaccat tgcagcgggt tctttatggg ctattctggg cgccgctctg       360
     cagtgttcgg cacagaatca caattggatg atttgcgccc gtttcgttaa tggtattgga       420
     accggaattt tgaacgctat cgtccctgtc tgggctaccg agacggctga acatacttcg       480
     cgcggacaat tcattgctat tgaatttacg ctcaacattt ttggtgttgt attggcttat       540
     tggttggagt ttggtctgtc tttcatcgac aacggagaat cagccttccg ctggagattc       600
     cccatcgcgt tccagatcgt cttccttatc gtcctcttcg cggttgtctg gttcttccca       660
     gagtcacctc gatggctcgt taaggtcggc cgggaggaag aggcccgcta tatcctacag       720
     cgtctacgtg gatctagcgg agaggatctc ctccgagccg aagcggagtt ccaggatatt       780
     ctcagcatcg ccgagctaga gcgcacagtc aatcacggtg actcgtatct gtctatgcta       840
     gttggctata aatccggtga ccttcatatc ggccgtcgtg tacagttagt catttggcta       900
     cagatcatgc aggaatgggt cggtatcgcg ggagttactg tttatgcacc tactatcttt       960
     ggaattgctg ggtttgattc aatgaagagt cagtggatca gtggactgaa caatatcttc      1020
     tatatgtttg ccacgctagt ctgtgtcttc actctcgacc gcatcggtcg tcggtggact      1080
     ttgtattggg gcgcgactgt ccagggtatt gccatgttcc tcggtggtgg attttcccgt      1140
     ctcgctatcg acagtaaggc agccggtgat atggccaagg catcttcgta tggtgcggcc      1200
     gcagcctcga tgattttcat cttcacctct gcattcggag cttcgtggct cacagtccct      1260
     tgggtgtacc cggctgaaat cttcccccta gccgttcgtg cccgtggaaa tgcttttggt      1320
     gttgtgggat ggagtatcgg aaatggatgg ctgactctac tgtgccccgt catgttcagt      1380
     gccatcggcg aaaagacgct gtacgtcttc gccgctagta acgtcattgc catccccatg      1440
     gtctgggctc tgtacccaga aagcaaccag cgcacgctag aggatatgga tctcctattc      1500
     gcggctaaga cgccctggac ctgggatgca gagaagacct ttgcgcgtct caaggcggag      1560
     aacccaggca tggtccagtc tctcggcccc aagggcagtc ttgtggaccc ggagactgga      1620
     aagcctcttt ctgctgctgc ggctgttgct gcttccaagg ctggtgataa tgctgtaggt      1680
     gcggagcatg tagatcacgc ttag                                             1704
//

If you have problems or comments...

PBIL Back to PBIL home page