(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE478

PENCW_16.PE478       Location/Qualifiers
FT   CDS_pept        join(complement(1079873..1080252),
FT                   complement(1079574..1079817))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978102"
FT                   /orf_name="Pc20g04780"
FT                   /product="Pc20g04780 protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP85807.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0001831841"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE86"
FT                   /transl_table=1
FT                   /translation="MQSPFSYPDSYSSSYSSSPGTMDFFFYGGQPVYDTLCDLDTTTSF
FT                   PMQEVTPEVYGITSSPYTYQRPQDFPVFERPVMPQSAPSSCGSSYSSSYSSSFNFPSED
FT                   VSLPSYPISEYEPSADSPAPASKPVKPFGCDHCGRAFTRFADLKRHQSSVHYPVFRNCP
FT                   VEHCSRKGSNGFPRQDHLVEHLRSYHHLDVPKRGSCKRSAKQMS"
     atgcaatccc cattcagcta cccagactcc tactcttcct cctactcctc ctcaccagga        60
     accatggatt tcttcttcta cggcggccag cccgtctacg ataccctctg cgaccttgac       120
     acgaccactt ccttccccat gcaagaggtc accccagaag tctacggtat taccagctcg       180
     ccctacacct accagagacc acaggacttc ccagtcttcg agcgacccgt catgccgcag       240
     agcgcaccca gcagctgtgg cagcagctac agcagtagct acagcagcag cttcaacttc       300
     ccctccgaag acgtctccct accaagctac cccatcagcg aatatgagcc tagcgccgac       360
     tcgccagcgc ctgcatccaa gcccgttaag cccttcggct gcgaccactg cggcagggcc       420
     ttcacccgct tcgcagactt gaagcgccac cagtccagcg tccactaccc cgtgttccgc       480
     aactgccctg tcgaacactg ctcgcgaaag ggtagcaatg gcttcccgcg tcaggatcac       540
     ctcgtcgagc acctgcgctc gtaccaccac ctggacgtgc cgaagcgcgg ttcctgcaag       600
     cgctctgcga agcagatgtc atga                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page