(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE479

PENCW_16.PE479       Location/Qualifiers
FT   CDS_pept        join(complement(1084013..1084267),
FT                   complement(1082455..1083932),complement(1082319..1082379))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184850" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949965"
FT                   /orf_name="Pc20g04790"
FT                   /product="Pc20g04790 protein"
FT                   /function="transcription regulator activity"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85808.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="InterPro:IPR007207"
FT                   /db_xref="InterPro:IPR007282"
FT                   /db_xref="InterPro:IPR012270"
FT                   /db_xref="UniParc:UPI0001831842"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE87"
FT                   /transl_table=1
FT                   /translation="MAARKTQQEIEKTFKKVSEGIQTFEGIYEKIRQATNPTQRDKLED
FT                   HLKREIKKLQRFRDQIKSWAAGNEVKDKAPLMEQRKAIEVCMEQFKAVEKEMKTKAYSK
FT                   EGLSAASRLDPKEKERVECSEFLSNMVDELQLKIEALEAEEETLHAQMKKGKKDTKKAD
FT                   RMADISHVTERHKWHVNKLEFLNRSLQNGNLDVGAVQDLKESIKYYVEEGGSPDYSGED
FT                   ETLYDDLNIGDDVEAQFGMGGDGDRVSSQDAQSVQDEEPEAKPKAKQEGPAARRPSTQM
FT                   KSPLPVLATLHPSASSSATPGMKPAPLPTRPPGETLKYASAAAAAAASDKSGVGILPLP
FT                   PPPGFSPALSVSLPVPKSSTASPSVASAQPVTKSIIPPTVAAVTEELSGPARSKAPVSG
FT                   NVSSPAPAKMETSTNGKPETEGTESEESVYHLPPGLQDLLQSFEVTKSRASANPSPSVQ
FT                   RLLATSLTTCPEAGDAEKPRHYKPQNPYSTALYYPQEPLSIFDDPRLYDTGRIDTDTLF
FT                   YLFYYRQGTYQQYLAAKALRNQSWRFHKQYQTWFQRHEEPKNITEEFEQGTYRFFDYES
FT                   TWMNRRKADFKFVYKYLEDEL"
     atggcagccc gaaaaacaca gcaggaaatt gagaaaacct tcaagaaggt ctccgaaggg        60
     atacaaacgt tcgaaggcat ttatgagaag atccgccaag ccacgaatcc cacgcagcgg       120
     gacaagctcg aagaccacct taagcgcgag atcaagaagc tccaaaggtt ccgtgatcag       180
     atcaaatcat gggctgctgg aaatgaagtc aaggacaaag ctccactcat ggagcagcgg       240
     aaggccattg aagtgtgcat ggaacaattc aaagccgtcg aaaaagagat gaagacgaaa       300
     gcatattcaa aggaaggtct atcggcagcc tcgcgacttg atccaaagga gaaggagagg       360
     gttgagtgtt ctgagttcct ctcaaacatg gttgacgagc ttcagttgaa gatcgaggcc       420
     ctagaggcag aggaggaaac ccttcatgcg caaatgaaga aaggaaagaa ggacacgaag       480
     aaggcggatc gaatggccga tatctcccac gttacggaac gacataaatg gcacgtaaac       540
     aagttggagt tcctcaatcg ttccttacag aacggcaacc tggacgtggg cgcggtacaa       600
     gacctcaagg aaagtatcaa atattacgtt gaggagggag gtagtcctga ctactccggc       660
     gaggatgaaa cgctctacga cgatttaaat atcggcgacg acgtcgaggc gcaatttggc       720
     atgggcggcg acggtgaccg cgtatcatca caagacgctc aatcagtcca agacgaagaa       780
     ccagaagcga aaccaaaggc caagcaagaa gggccagcag cccgaagacc atcgacacag       840
     atgaaatcgc cgctgcctgt tcttgctacc ctccacccgt ctgcttcgtc gagtgccact       900
     cccggcatga agcccgctcc ccttccgacc cgccctcctg gtgaaaccct caagtatgcc       960
     tctgctgcag ctgcagccgc agcaagtgac aaaagtggtg ttggcattct tcctcttccg      1020
     cctccaccag ggttcagccc ggctctgtca gtgtcattac ctgtccccaa gtcttctact      1080
     gcttcgccta gtgtggcgtc agcacagcct gttaccaagt caataatccc acctactgta      1140
     gcagccgtta cggaagagct ttctgggcct gcgcgatcga aggcccctgt gagtggaaac      1200
     gtttcatcgc cagcgcccgc aaagatggag acctcaacga atggaaagcc agagacagaa      1260
     gggactgaaa gtgaagaatc ggtatatcat ctgccccctg gtctccagga tctgctccaa      1320
     tcattcgagg tgacgaagtc gcgtgcgtcg gccaatccat cgccgtctgt ccagcgcctt      1380
     ctcgctacct cgttgacgac atgtcccgaa gctggtgatg ctgaaaaacc acgtcattac      1440
     aagccgcaga acccctacag cacagcgctc tactacccac aggaacctct ctcaatattc      1500
     gatgaccccc ggttgtatga taccgggaga atcgacacag atactctctt ctacctgttc      1560
     tactaccgcc aagggacgta ccaacaatac ctcgccgcca aggcgctccg aaaccagagt      1620
     tggcgcttcc ataagcagta tcaaacctgg ttccagcgtc acgaggagcc gaagaacatt      1680
     accgaggagt tcgaacaagg cacctatcgc ttcttcgact acgaaagcac atggatgaat      1740
     cggcgcaagg ctgatttcaa gtttgtgtac aaatacctcg aggacgagtt atga            1794
//

If you have problems or comments...

PBIL Back to PBIL home page