(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE48

PENCW_16.PE48        Location/Qualifiers
FT   CDS_pept        join(108359..108413,108485..108624,108677..108805,
FT                   108866..109105)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233973" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128434"
FT                   /orf_name="Pc20g00480"
FT                   /product="Pc20g00480 protein"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP85377.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003577"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR015602"
FT                   /db_xref="InterPro:IPR020849"
FT                   /db_xref="UniParc:UPI0001831AB3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFN7"
FT                   /transl_table=1
FT                   /translation="MPSAPKQRKIAIVGSRSVGKSSLTVRFVEHHFVESYYPTIENTFS
FT                   RIIKHNGQDYATEIVDTAGQDEYSILNSKHFIGIHGYIIVYSVTSRQSFDMVRVIRDKI
FT                   LNHLGADDVPLVIVGNKSDLKPDHRQVTLDDGRQLAEELNCAFTEASAFLDFNVSKAFD
FT                   LMIGEVEKSQNPSQPTGNNKCALM"
     atgccttccg cgcctaagca gagaaagatc gcaatcgttg gcagtcggtc cgtgggcaaa        60
     tcatctctca cggttcgctt cgtcgagcac cacttcgtgg aaagctatta ccctacaatt       120
     gagaacacat tcagtcggat tatcaagcac aatgggcagg actatgcaac cgagatcgtc       180
     gacactgcgg gacaggacga atatagtatc ttgaactcca aacatttcat tggaattcat       240
     ggatatatca ttgtctattc agttacatcg cgccagtcat ttgacatggt gcgggtgatt       300
     cgtgacaaga tcctgaacca cctcggagcg gatgatgtac ctcttgttat agtaggaaac       360
     aagagtgatc tcaagcccga tcaccgccaa gtcaccctcg atgacggacg gcaattagcg       420
     gaggagctca actgcgcttt cactgaggct agtgccttcc ttgatttcaa tgtttcgaag       480
     gcctttgatc tcatgatagg agaggttgag aagtctcaaa atccatcaca accaactggg       540
     aacaacaagt gtgctttgat gtaa                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page