(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE480

PENCW_16.PE480       Location/Qualifiers
FT   CDS_pept        join(1084791..1084797,1084850..1085028,1085080..1085122,
FT                   1085184..1085410,1085478..1085609)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000113981" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949966"
FT                   /orf_name="Pc20g04800"
FT                   /product="Pc20g04800 protein"
FT                   /function="hydrolase activity, acting on ester bonds "
FT                   /biological_process="D-amino acid catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP85809.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016788"
FT                   /db_xref="GO:0019478"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="UniParc:UPI0001831843"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE88"
FT                   /transl_table=1
FT                   /translation="MKLVIQRVKSASVTVDSELISSIGKGLLVFAGVGKEDTEKDAENL
FT                   VNKVLKAKFWPDENGVQWKKNVKDIEGEVLCVSQFTLYAKMKKGNKPDFHDAAAPEPAR
FT                   KLYDFFYAKMGEGYTPDRVKNGVFQAMMDVELKNDGPVGVNYCSEDAAVTIEINTNLPK
FT                   KEPKEQQNGDKKTDEQEIKGSFEFQIPPELLQ"
     atgaaactcg ttatccaaag agtcaaatcg gcatccgtca cagtcgactc ggagttgata        60
     tcctcaattg gcaagggcct gcttgtgttt gctggggttg gcaaagaaga taccgagaag       120
     gatgctgaga acctggtgaa caaggtgttg aaggccaagt tctggcctga tgagaatgga       180
     gtacaatgga aaaagaacgt gaaggatatt gagggggaag tactatgtgt ctcccaattc       240
     accctctatg cgaaaatgaa gaaaggcaac aaacccgact ttcatgatgc agctgcaccg       300
     gaacccgcac gcaaactcta tgacttcttc tatgccaaga tgggcgaagg ctatactcca       360
     gaccgggtca agaatggtgt cttccaagcc atgatggacg ttgaactgaa gaacgacggg       420
     ccggtgggtg taaattactg cagcgaggac gcggcggtca cgatcgaaat caataccaat       480
     cttcccaaga aggaacccaa ggagcagcaa aatggagaca agaagaccga tgagcaggaa       540
     attaagggat ctttcgaatt ccaaattcct cctgaattgc tgcagtga                    588
//

If you have problems or comments...

PBIL Back to PBIL home page