(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE481

PENCW_16.PE481       Location/Qualifiers
FT   CDS_pept        join(1085871..1085886,1085956..1086020,1086083..1086092,
FT                   1086147..1086233,1086297..1087237)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000065980" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949967"
FT                   /orf_name="Pc20g04810"
FT                   /product="Pc20g04810 protein"
FT                   /function="binding"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="CAP85810.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="UniParc:UPI0001831844"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE89"
FT                   /transl_table=1
FT                   /translation="MATAQRSRVFFDIKIGDSKPSRVAFELFNDVVPKTADNFRALCTG
FT                   EKGIGTQGKELTYKGSIFHRVIKQFMIQGGDFTAFNGTGGESIYGEKFPDENFDLKHDR
FT                   PFLLSMANSGPGTNGSQFFVTTVPTPHLDGKHVVFGEVINGKSVIRKIENVKTQSDKPF
FT                   QDVTIVDCGELSGEDYENATKRQQDATGDPYEDFTEDHQGEELTAPLCFKIASDLKGFG
FT                   NTAFKSGDLDLGLDKYQKGLRYLNEFPDPGENDPKELGEQMKALRFTLHSNSSLLANKL
FT                   QKYRQAQNWATYALQVADSANAKDADKAKAYYRRAVAHGGLKEEEEALKDLQEAEKLAP
FT                   GDAGILNEIAKVKKTVKDREAKDKAAAKKFFS"
     atggcgactg ctcagcgctc ccgtgtcttc tttgacatta aaatcggtga cagcaagccc        60
     agccgagtgg catttgagct gttcaacgat gttgtcccca agaccgcgga taacttccga       120
     gctttgtgta ccggcgagaa gggcattggc acccagggca aggaattgac ctacaaaggc       180
     tcaattttcc accgtgtgat caagcagttc atgattcagg gtggtgactt cactgcgttc       240
     aacggcaccg gcggcgagtc aatttacggc gaaaagttcc ccgatgagaa cttcgacctc       300
     aagcatgacc gtcccttcct gctctctatg gccaactccg gccccggcac caacggtagt       360
     caattcttcg tcaccaccgt ccctactccc caccttgatg gcaagcacgt cgtgttcggt       420
     gaggtcatca acggcaagag tgtgatccgc aagatcgaga acgtgaagac tcaatcggac       480
     aagcccttcc aggacgtgac tatcgtggac tgcggcgaac tttctggcga ggattacgag       540
     aacgcgacca agcgccaaca ggatgcgaca ggtgacccat acgaggactt caccgaggac       600
     caccagggcg aggagcttac tgcgcctctc tgcttcaaga tcgcttcgga cctcaagggt       660
     ttcggcaaca ctgccttcaa gagcggtgat ctcgacctgg gtctcgacaa gtaccagaag       720
     ggtctgcgct atctgaacga gttccccgac cccggagaga acgaccccaa ggagctgggt       780
     gagcagatga aggctctccg attcaccctg cactccaact cttctctgct cgccaacaag       840
     ctgcaaaagt accgccaggc tcagaactgg gcgacatacg cgcttcaagt cgctgattcg       900
     gcgaacgcca aggatgccga taaggccaag gcctactatc gccgtgctgt tgctcacgga       960
     ggtctgaagg aggaggagga ggcgctgaag gatcttcagg aggcggagaa gctggctcct      1020
     ggcgacgctg gtatcctcaa cgagatcgct aaggttaaga agaccgtcaa ggaccgggag      1080
     gccaaggaca aggccgctgc caagaagttc ttctcttga                             1119
//

If you have problems or comments...

PBIL Back to PBIL home page