(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE482

PENCW_16.PE482       Location/Qualifiers
FT   CDS_pept        join(complement(1089126..1089200),
FT                   complement(1089057..1089075),complement(1088696..1088984),
FT                   complement(1088360..1088636),complement(1087727..1088305))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000080362" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949968"
FT                   /orf_name="Pc20g04820"
FT                   /product="Pc20g04820 protein"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds, in linear amides"
FT                   /protein_id="CAP85811.1"
FT                   /db_xref="GO:0016811"
FT                   /db_xref="InterPro:IPR004304"
FT                   /db_xref="UniParc:UPI0001831845"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE90"
FT                   /transl_table=1
FT                   /translation="MGIKGIRTALKVDLNKLAREQPGLHNRWHPDVPSYGKIVNNEVVK
FT                   IECLDWTGGQIGNNDSADDIKNVDLTQIHYLSGPFDIETAEPGDVLLVEIQDVQPFEEQ
FT                   PWGFSGVFHKENGGGFLDHLYPEAAKAIWDFEGIFCSSRHIPHVRFAGLIHPGILGCAP
FT                   SAEVLAEWNRREGELIATNTVADRIVAQPPNPRNAHSGHATDEVKNKIANEGARTIPGR
FT                   PEHGGNCDIKNLSRGSKVYLPVHVPGAKFSVGDLHFSQGDGEISFCGAIEMAGVITLKF
FT                   TVIKNGMAKLDMKSPIFHAGPVEPQFGPGRYLTFEGFSVDENGKQHFLDATVAYRQTCL
FT                   RVIEYLRRYGYSDYQIYLLLSCAPVQGHIAGIVDIPNACTTLSVPMDIFDFDIRPEADV
FT                   VKKDMGACAFVTK"
     atgggtatca agggaattcg taccgctctc aaggtcgacc tcaacaagct tgcgcgtgaa        60
     cagcctggct tacataacag atggcatcca gacgttccat cctatggaaa aattgtcaac       120
     aatgaagttg tcaagatcga atgtctggac tggaccggag gccagatcgg aaacaacgac       180
     tcagccgacg atatcaagaa cgtagatcta acccaaatcc attacctgtc tggtccattc       240
     gacatcgaaa ccgcagagcc tggtgatgtc ttacttgtcg agattcagga cgtccaacca       300
     ttcgaagagc aaccatgggg attcagcgga gtcttccaca aagagaatgg aggaggcttc       360
     ttagatcact tgtatcctga ggcagccaag gccatctggg attttgaagg aatcttctgc       420
     tcatctcgcc atatcccgca tgttcggttt gcgggactta tccaccctgg aatcctgggg       480
     tgtgctccat cggccgaagt cctggctgaa tggaatcgtc gagaggggga gctgattgcg       540
     accaatactg ttgctgatcg aattgtcgcc cagccaccaa atccccggaa tgctcattct       600
     ggccatgcca ccgatgaggt gaagaacaag atcgccaatg agggtgctcg aaccatccca       660
     ggccgtcccg agcacggggg caattgcgat atcaagaacc tctctcgcgg atcgaaggtt       720
     taccttcccg tccacgtccc aggcgccaaa ttctccgtcg gagaccttca cttctcgcaa       780
     ggcgatggcg agatctcatt ctgcggcgcc atcgaaatgg ccggtgtaat cacactgaag       840
     ttcacagtca tcaagaacgg catggcgaaa ctggacatga agtcaccaat tttccatgca       900
     ggccctgtag agccgcagtt cggccctgga cgatacctca cgttcgaggg tttctctgtc       960
     gacgagaatg gcaagcaaca tttcttggat gcgacagtcg cctatagaca gacttgtctc      1020
     cgagttattg agtatctccg gcgctatggc tatagtgatt atcagatata tttgctgctc      1080
     agttgtgcgc cggtgcaggg tcatattgcc ggcattgtgg atattcctaa tgcttgtacc      1140
     acgctttccg taccgatgga tatctttgat ttcgatattc gacctgaggc ggatgtggtc      1200
     aaaaaggaca tgggagcttg cgctttcgtg acaaagtag                             1239
//

If you have problems or comments...

PBIL Back to PBIL home page