(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE483

PENCW_16.PE483       Location/Qualifiers
FT   CDS_pept        join(complement(1091115..1091172),
FT                   complement(1090755..1090861),complement(1090527..1090699),
FT                   complement(1090079..1090472),complement(1089672..1090028))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184851" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949969"
FT                   /orf_name="Pc20g04830"
FT                   /product="Pc20g04830 protein"
FT                   /biological_process="cysteine biosynthetic process "
FT                   /cellular_component="Gram-negative-bacterium-type cell wall"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP85812.1"
FT                   /db_xref="GO:0009276"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0019344"
FT                   /db_xref="InterPro:IPR007496"
FT                   /db_xref="UniParc:UPI0001831846"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE91"
FT                   /transl_table=1
FT                   /translation="MSNFEPNAVIRGFQLTVVGTVRALANPELFKYDHFRQAALAIAIG
FT                   TVIQLIIQIPIFSVKFSIYILSWVVNLEQAVWDDKLLNGLEFMSKSVLQVPFLLMTLMR
FT                   YVTPTLDEIFMQSIQWVDTTYIQKHKSEDPRQLRSLYYPNLVQYSTKGGSSVSRSIPEA
FT                   LRSFFNRYAKKIGMMLGLYLLSMVVIIGRFVMPAASFYTFRSHVGSTPAAVIFGVGLFL
FT                   PKKYIVTFLHTYFASRSLMRELLEPYFWRIKFTPEQKRRWFRDREGVLFGFAFAFTVLL
FT                   RIPYIGVLMYGVAEASTAYLVTKITDPPPPPAESTNFAESQVTWRNKHDFLRLSLDNLD
FT                   KLNVDTVERDDKDSGSPGKKFS"
     atgtcgaact tcgagccaaa cgcggtgatc cgcggcttcc agctcacagt ggtaggcact        60
     gttcgtgcat tagcaaaccc tgagctattc aagtacgacc atttccgcca agcagctctc       120
     gcgatagcga tcggcaccgt gatccaactg atcattcaaa ttccaatatt cagcgtaaaa       180
     ttctccattt acatcttatc atgggtggtc aacctggagc aggcagtctg ggacgacaag       240
     cttctcaatg gattggaatt tatgtcaaag tctgtccttc aggtgccatt cttgctgatg       300
     accttgatgc gatatgtgac gcccacgttg gatgaaatat tcatgcagtc catccaatgg       360
     gtggacacca catacatcca gaaacataaa tccgaagatc ctcgtcaact acgctctcta       420
     tactatccca atctcgttca gtactctacc aaaggtggct ccagcgtttc tcggtcaatc       480
     cccgaagcat tgaggtcatt cttcaatcgc tatgcaaaga agatcggtat gatgcttggt       540
     ctgtatcttc tctcgatggt tgtaattatt ggtcggttcg tcatgcctgc agcaagtttc       600
     tacacattcc gaagccatgt tggttccact cccgcggctg tcattttcgg tgtagggttg       660
     tttctgccga agaagtatat tgtcacattc ctccacacct actttgcttc ccgcagtcta       720
     atgcgtgagc ttctcgaacc ctacttttgg cgcattaagt tcacccccga gcaaaagcgt       780
     cggtggttcc gtgaccgaga aggtgttctc ttcggctttg ccttcgcttt cacggttctt       840
     ctgcgcatcc catacatcgg tgtgctgatg tatggcgttg ctgaggcatc tacagcgtac       900
     cttgtcacca agatcaccga cccgcctcca ccccccgctg aaagtacgaa ctttgcggaa       960
     agccaggtaa cctggaggaa caagcatgat ttcttgcgtt tgtctctcga caaccttgac      1020
     aagctcaatg tcgacacggt cgagcgcgat gacaaggact ctggctcccc aggaaagaag      1080
     ttctcttga                                                              1089
//

If you have problems or comments...

PBIL Back to PBIL home page