(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE484

PENCW_16.PE484       Location/Qualifiers
FT   CDS_pept        1091509..1093689
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184862" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129271"
FT                   /orf_name="Pc20g04840"
FT                   /product="Pc20g04840 protein"
FT                   /protein_id="CAP85813.1"
FT                   /db_xref="UniParc:UPI0001831847"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE92"
FT                   /transl_table=1
FT                   /translation="MPESPSELGQIQSLRRSLTLPTKLNPLAQRRSSVPNTPEHVIFYH
FT                   PSAKIVHFSPRALAPIPSSSAPSDFDYPVDTIETLPWRSATERTVATAPLRLEKVHGST
FT                   AFLKCGNVVHAILKNSQCWCVDGVSKFVLRIRPLTYYRIEIPYETEDERSLVRDLKIAL
FT                   PTVLRYEVTPCPFKRAFSVELPSDAMAPRRKKAWQPKDRRERVPTVLEPRRETPSPSSI
FT                   RSDCIDSASTGDDTDGNLTDDSCFTSNKANSTVLETIPDDRESSPVEALSPSPYLGPPR
FT                   RSVSETPQTFTSLLAKFEATSVAENDQDSELVLKPEYASRADVVPEIDHELKVAEQLEP
FT                   EFLADGVEAGPGSETVLDAESKTAAQPGDKPEHDPEAILHAGRSSEAAVKEEPIISAET
FT                   DAALAAETSEEAVFRAEPTTAVEAEAVPEGNVMNVEGVQIIQPAAEPTLDIDHDASFAS
FT                   NPESFHSAEPHSPDSVSTHPTSVGGHELPESEEKFNISSTNHIISGYESAPADPCKTSQ
FT                   PPTLNIPQSDHASNQTSLPGPPLVHGTSSNNLPRRFADAFSDTSPSMAPTSNENPPSRS
FT                   TDASSDTHMRPSVHAKAAPLNTDFDHMSAEFRRRSKATRERDVSPMPHSSALYQPSGDD
FT                   GTSFISKAITLVLIPPAYLFVILLHIAARVVISPAIHPTISSTSSEPHSQPQQTRKDPA
FT                   AEDDFSFPLEPQTSSEYEDAQLFKKLDPWDLD"
     atgcccgagt ctccaagtga gctaggtcag atacaatccc tccgccgctc cctcaccctt        60
     cccaccaagt taaatccact tgcgcaacgt cgctcgagcg tgccgaatac ccccgaacat       120
     gtaattttct atcacccgtc tgcgaaaatt gtgcatttct ccccaagagc gctcgccccg       180
     attccttcca gttctgcgcc gtccgacttc gactacccgg tagacaccat cgaaacactc       240
     ccctggcgct ctgcgactga acggaccgtc gcgacagcgc cactgaggct ggagaaggtc       300
     catggctcaa cagcgtttct caaatgtgga aatgtcgtcc atgcgatcct gaaaaattcc       360
     cagtgttggt gtgttgacgg ggtctcaaag tttgttttac gcattcgccc tcttacatac       420
     tatcgcatcg aaataccata tgagacggaa gatgagcgaa gcttagtacg ggatctgaag       480
     atcgcattgc caacagtgct tcggtatgag gtcacgccat gtcctttcaa acgcgctttt       540
     agtgtggagc tccccagtga cgcgatggca cctcggcgca aaaaggcctg gcaacctaaa       600
     gatcggagag aaagggtacc gactgttcta gaaccccgac gagagacacc gtcaccatct       660
     tcaatcaggt cggattgtat cgactccgcg agcactggcg acgacacgga cggaaactta       720
     accgatgaca gttgtttcac ttcaaacaaa gcgaacagta cagttttgga gactatccct       780
     gacgatcggg aatcttctcc tgttgaggct ttgagtcctt cgccatacct tgggcctcct       840
     aggcgctcgg tgtccgaaac accgcagact ttcactagcc tgcttgcaaa gtttgaggct       900
     acatccgttg cagagaatga tcaggactct gaacttgtgc tcaagccaga atacgcctcc       960
     agggccgatg ttgtacccga aattgaccat gaactcaagg ttgccgagca actcgaaccc      1020
     gagtttctag ccgatggagt tgaagctggg cctggatccg aaactgtact agatgcggaa      1080
     tctaaaaccg cagcacagcc tggggacaag cctgaacatg atccagaagc tatattgcac      1140
     gccggacgtt ccagtgaagc tgcagttaaa gaggagccca tcatttcggc tgagaccgac      1200
     gcagcgttgg cggctgaaac ttcagaggaa gctgtattcc gtgctgagcc caccacagca      1260
     gtcgaagccg aggcagtacc ggaaggtaat gtcatgaatg tggaaggagt tcaaatcatc      1320
     caacccgctg ccgagccgac actggacatt gaccatgatg cctccttcgc gtccaacccc      1380
     gagtcgttcc attctgctga acctcattcg ccggattcag tctctactca tcctacatct      1440
     gtgggaggcc acgagttgcc agagtcagaa gagaagttca atatttcgag cacaaaccac      1500
     atcatttctg gatacgaatc agcaccagcg gatccgtgta agacgtcgca gcccccaaca      1560
     ctcaatattc ctcaaagcga tcacgcctcg aatcaaacca gcttgcccgg tcctccatta      1620
     gtgcatggta caagttcgaa taatctgccc aggcgcttcg cagatgcatt ctctgacacc      1680
     tcgccctcaa tggcccctac aagcaatgag aatccaccca gtcgttctac ggatgcgtct      1740
     tcggacactc acatgcggcc aagcgttcat gccaaggccg ctccattgaa tactgatttc      1800
     gatcacatga gtgctgagtt ccggcgccgg tcaaaagcca caagagagcg tgatgtttcc      1860
     cctatgcctc attcttcggc attgtaccaa ccatccggtg atgatggcac atccttcatt      1920
     tccaaggcta tcaccctagt attgataccc cccgcctatc tttttgttat tctccttcat      1980
     atcgctgcgc gcgttgtcat cagcccagct atccacccga ccatcagctc cacgtcgagc      2040
     gagccacact cccagcccca gcaaacaagg aaggatccag ccgcagagga tgacttcagt      2100
     ttcccactgg agcctcagac ttcctcggaa tacgaggatg ctcaactctt caagaaactc      2160
     gatccttggg atctggacta g                                                2181
//

If you have problems or comments...

PBIL Back to PBIL home page