(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE485

PENCW_16.PE485       Location/Qualifiers
FT   CDS_pept        join(complement(1094814..1094840),
FT                   complement(1094364..1094723))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184883" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978103"
FT                   /orf_name="Pc20g04850"
FT                   /product="Pc20g04850 protein"
FT                   /function="7S RNA binding"
FT                   /function="endoplasmic reticulum signal peptide binding "
FT                   /biological_process="SRP-dependent cotranslational protein
FT                   targeting to membrane"
FT                   /biological_process="negative regulation of translational
FT                   elongation"
FT                   /cellular_component="signal recognition particle,
FT                   endoplasmic reticulum targeting"
FT                   /protein_id="CAP85814.1"
FT                   /db_xref="GO:0005786"
FT                   /db_xref="GO:0006614"
FT                   /db_xref="GO:0008312"
FT                   /db_xref="GO:0030942"
FT                   /db_xref="GO:0045900"
FT                   /db_xref="InterPro:IPR003210"
FT                   /db_xref="InterPro:IPR009018"
FT                   /db_xref="UniParc:UPI0001831848"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE93"
FT                   /transl_table=1
FT                   /translation="MAPHLGQDEFFKSLGELLSKTSQQHQGSVYLTQKPLIDVPGATTT
FT                   NSQPSILIRATDGNTNTPNLKKEGKDKKSQKVKLSTIVNPDEIEAFYVRYAEVCKAGMT
FT                   GLKKRDRRGRKAKTKGGAAKVTKA"
     atggccccac atttgggaca agacgagttc ttcaaatctc tcggcgaact gctctccaag        60
     acctcccagc aacaccaagg ctcggtatat ctcactcaaa aacctctcat tgatgtgcct       120
     ggtgccacta ccacaaattc ccaaccatct atcctcatcc gcgccactga tggaaacacc       180
     aatacgccga acttaaagaa ggaaggcaag gacaaaaagt ctcagaaggt caagctctcc       240
     acaattgtca acccagatga aattgaggca ttctacgttc gctatgctga ggtctgcaag       300
     gcaggcatga ctgggttgaa gaagcgagat cgccgaggcc gcaaggctaa gaccaagggc       360
     ggagctgcta aggtcacaaa agcatag                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page