(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE486

PENCW_16.PE486       Location/Qualifiers
FT   CDS_pept        join(1095157..1095225,1095291..1096605,1096662..1097848)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184884" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949970"
FT                   /orf_name="Pc20g04860"
FT                   /product="Pc20g04860 protein"
FT                   /function="binding"
FT                   /biological_process="RNA metabolic process"
FT                   /protein_id="CAP85815.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016070"
FT                   /db_xref="InterPro:IPR003890"
FT                   /db_xref="InterPro:IPR003891"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0001831849"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE94"
FT                   /transl_table=1
FT                   /translation="MSTVTRSVASTDLPRAKNAAKMSRSQQKPQKRARGDSDEDSADED
FT                   LDLNSDDMDLDEGLSEPQTKSKSAKEAAKKPKSILKKAAVPQDSESDSEPESGFGSEID
FT                   LDEDEDEDEDEDEDEDEVDESDDESEDDTYEGEPKETEAHIPGSVKAKLAQDDAEIAEL
FT                   EKRLGLKKGGKLPKAFEEDGLDELLGDLAGGADASEDESKKRKREADDWLRNKRLKAKS
FT                   LQAQQVEKDESEMDSAEDFDLDEEIFGGDDSDEAAEGSDFDGFDEEEPKEPKKKENPYI
FT                   APVTKPEATAQKYIPPSLRARSDPESESLTRLKRQAQGHLNKLSEANMLSIVAEFEKLY
FT                   RDYPRQHVTSTLVSLLMGLICERAALQDTFLILHAGFIAALYKLMGMDIGAEIIQTVVE
FT                   TLDAGGDERGSFQGKEATNLVSLLSQLYNFHVVGSSLMFDYVRLYVQDITESNTELLLK
FT                   VIRNSGPQLRLDDPSALKDIVLLIQPAVAKAGEDRLSVRTKFMIDLITDLKNNRSKASA
FT                   AAGAGITTEHITKMRKILGSLNSSRVIRASEPINISRDDIHNSSKKGKWWLVGASWKED
FT                   PLVTAQREMAGVQVTQPEARDDESDGEPDFGVLARAHRMNTDVRRSIFVAIMSANDFQD
FT                   AHVRLMKLRLKRAQEFEIPRVLLHCAMEEEAHNPYYSLIARRICGEQGRRIKMSFMFAL
FT                   WNVFKKMGERGDIDDDEETNFDPDDEENGVSMKSVVNLAKMFSTLIVDGTLTLSILKNL
FT                   NFAYLQPKTKTFVEVLVISIIQQSQKSKKKKKSKSSMPDESEKNEGPLMQIFLRVKETP
FT                   HIAKGLIYFVRKVVAKSDIVSSEELKLVRWGCNVAADALKAVAE"
     atgtctacgg tgacaagaag cgtcgcctca acggacctgc ctcgcgcaaa gaacgccgcc        60
     aaaatgagcc ggagccaaca gaaacctcag aagcgggctc ggggtgatag cgatgaggac       120
     agtgcggacg aggatcttga ccttaactca gacgacatgg atctcgacga gggactcagt       180
     gagccgcaga ccaagtccaa gtccgcgaaa gaggctgcga agaagcccaa atctatcctg       240
     aagaaagcag cagtcccaca agactccgag tccgattccg agcctgagtc cgggttcggg       300
     tcagagatcg acctcgatga ggatgaggat gaggatgagg atgaggatga ggatgaggat       360
     gaggttgacg agtcagacga tgagtcggag gacgacacct acgagggtga acccaaagaa       420
     actgaggccc acatcccagg atctgtcaag gctaagctgg cgcaagacga tgccgagatt       480
     gctgagttgg agaaaaggct tggcctcaag aagggtggta aattaccaaa ggcctttgag       540
     gaggatgggc tagatgaatt gctgggagat ttggctggtg gcgccgatgc ctcagaggat       600
     gagagcaaaa agcgcaaacg agaagccgat gattggctac gaaacaagag actcaaggcc       660
     aagagcttgc aagcccaaca agtcgaaaaa gatgaaagcg aaatggatag cgccgaggat       720
     ttcgatcttg acgaggagat atttggagga gacgattctg atgaggccgc cgaaggcagt       780
     gatttcgacg gtttcgatga ggaagagccc aaagagccaa aaaagaagga aaatccctat       840
     atcgccccgg tcacgaagcc tgaagccacc gctcagaagt acattccacc ttcactacga       900
     gctcgctccg atccggagag cgaatctctc acccgtctca agcgccaggc ccagggacat       960
     ctcaacaagc tgtccgaggc aaatatgctc tcgattgttg ccgaattcga aaagctttac      1020
     cgcgattacc ctcgccaaca cgttacatct actttggtta gcctactaat gggattgatc      1080
     tgcgagaggg ctgcccttca ggacaccttc ctcatcttgc atgcaggttt cattgccgcg      1140
     ttgtataagc tcatgggaat ggacattggc gcggagatta ttcaaaccgt cgtcgaaaca      1200
     ttggatgctg gtggcgacga gcgcggaagt ttccaaggaa aagaagctac caacttggtc      1260
     tctcttctct cgcaacttta caacttccac gtcgtcggtt cttccctgat gtttgactac      1320
     gttcgtcttt acgtgcagga tatcacggaa tcaaacaccg agctcctgct caaggtcatt      1380
     cggaattctg gccctcaact ccgactcgat gacccgtctg cgctcaagga tattgtattg      1440
     ctcattcagc ctgccgtcgc gaaggctggc gaggacagac tttctgtgcg aacaaagttt      1500
     atgattgatt tgatcacgga tttgaaaaat aaccgctcga aagcttccgc cgcggctggc      1560
     gcaggtatca ccacagaaca cattaccaaa atgcgcaaga ttttaggttc tttgaacagc      1620
     tctcgtgtga tccgcgcatc agaacccatt aacatctccc gcgacgatat ccacaactcc      1680
     tccaagaagg gcaagtggtg gttggttggc gcaagctgga aggaagatcc tcttgtaaca      1740
     gcacaaagag aaatggctgg tgtacaagtg acccagcctg aagccagaga tgacgagagt      1800
     gatggcgagc ctgactttgg agttctcgcc cgagcccacc gtatgaacac tgatgttcgt      1860
     cggtcgatct ttgttgccat tatgtctgcc aacgacttcc aagatgcaca tgtccgactc      1920
     atgaaacttc gtctcaagcg cgcacaggaa tttgaaattc ctcgtgtcct tctacactgt      1980
     gcgatggagg aggaggccca caacccatac tattctctaa tcgcgcgtcg gatttgcggt      2040
     gagcagggtc gacgcatcaa aatgtccttt atgtttgcac tttggaatgt gttcaagaag      2100
     atgggtgagc gaggagatat tgacgatgac gaagagacca acttcgatcc agacgacgag      2160
     gagaacggcg tcagcatgaa gtccgtggtc aacttggcca agatgttcag caccctcatt      2220
     gtggatggca ccttgacatt aagcatcttg aagaacctca acttcgcata cctgcagccc      2280
     aagactaaga catttgttga agttctggtc atcagtatca ttcaacaatc ccaaaagtcg      2340
     aagaaaaaga agaagtcaaa gagctctatg ccagatgagt ctgagaagaa tgaagggcct      2400
     ttgatgcaaa tattcctacg tgtcaaggag acaccacaca ttgccaaggg tcttatctat      2460
     tttgtgcgaa aggttgtcgc gaagagtgat attgtgtcct cagaggaact gaaacttgtt      2520
     cggtggggtt gcaatgtggc tgcagatgcc ctcaaggctg tggcggagta a               2571
//

If you have problems or comments...

PBIL Back to PBIL home page