(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE49

PENCW_16.PE49        Location/Qualifiers
FT   CDS_pept        join(109708..109840,109891..109961,110016..110177,
FT                   110244..110665,110717..110807,110858..111226,1
FT                   11280..111444)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000035937" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824089"
FT                   /orf_name="Pc20g00490"
FT                   /product="Pc20g00490 protein"
FT                   /function="ATP binding"
FT                   /function="serine-tRNA ligase activity"
FT                   /biological_process="seryl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP85378.1"
FT                   /db_xref="GO:0004828"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006434"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="UniParc:UPI0001831AB4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFN8"
FT                   /transl_table=1
FT                   /translation="MLDLADFVTERGGDIKKIKESQQKRFAPEEAVDEVVALYEEARRA
FT                   RYDVTQMGSQINGVQKAIGMKKKNKEDATELLAQKAELETKKKELEEAAVAKEVQRDRK
FT                   IRTIGNYVHESVPVSNDEADNKLIKTWTPEGAEMQKPGCLSHHEVLTRLDGYDPERGVK
FT                   IVGHRGYCLTGYGLFLNLALINYGLEFLFNKGYTPNQPPQFMLKDLMAKTAQLEQFDEE
FT                   LYKVTESEDKSTDKYLIATSEQPLSALHDSEWLQDKDLPIKYAGYSTCYRKEAGSHGKD
FT                   AWGIFRVHQFEKIEQFVLTKPEDSWQAFEDMMNTSEEFYQSLKLPYNIVAIVSGALNNA
FT                   ASKKYDLEAWFPFQQEYKELVSCSNCTDYQARALEIRYGAKKATDLKKTYVHALNSTLC
FT                   ATERTLCCVLENYQKEDGIEVPEVLRKYIPGAPEFLPYTKELPKDTTSSKAKAKANKGT
FT                   DDAAKKMQGLQV"
     atgctggacc ttgcagactt tgtcaccgag cgcggtggtg atatcaagaa gatcaaggaa        60
     agccagcaga agcgatttgc tccggaggag gccgttgatg aagttgtcgc gctttatgaa       120
     gaggcacgac gcgcccggta cgatgtcaca cagatgggtt ctcagatcaa tggagtccag       180
     aaggcaattg gtatgaagaa gaagaacaag gaagacgcaa ccgagttgct cgcacaaaag       240
     gcagagcttg agacaaagaa gaaggagctg gaggaagctg ctgtcgccaa ggaggttcaa       300
     cgcgaccgga agattcgcac gattggaaac tacgtccacg aatctgtgcc cgtgagcaac       360
     gatgaggcag acaacaagct gatcaagaca tggacccccg agggcgccga aatgcagaag       420
     ccgggctgcc tctcccacca cgaagtgttg actcgtctcg atggatatga cccagagcgt       480
     ggtgtcaaga ttgttggcca ccgtggatac tgcttgactg gctacggtct tttcctcaac       540
     ttggctctga tcaactatgg tctggagttc ctcttcaaca agggctacac acctaaccag       600
     ccccctcagt tcatgctcaa ggatctcatg gcgaagactg cgcagctcga gcaattcgac       660
     gaggagttgt ataaggttac tgagagcgag gataagtcga ccgacaagta cctcattgct       720
     acctccgagc aaccattgtc tgccttgcac gatagcgagt ggctccagga taaggaccta       780
     cccatcaagt atgccggtta cagcacatgc taccgcaagg aggctggatc tcacggaaaa       840
     gatgcctggg gtatcttccg tgtccaccaa ttcgaaaaga ttgagcagtt cgttcttaca       900
     aagcctgagg attcatggca agcctttgag gacatgatga acacttcaga agaattctac       960
     cagtccctaa aactccctta caacattgtc gccattgtct ccggcgcctt gaacaacgcg      1020
     gcatccaaga agtacgactt ggaggcctgg ttccccttcc agcaggagta caaggagctc      1080
     gtctcttgct ccaactgtac cgactaccaa gcccgagctc tggagatccg gtacggcgcg      1140
     aagaaggcca ctgatctgaa gaagacttac gtccatgcac tgaactccac tctgtgcgcg      1200
     acggagcgta ctctctgttg tgtgcttgag aactaccaga aagaagatgg tattgaggtc      1260
     ccagaggtcc tgcggaagta catccccggt gctcctgagt tcctccctta caccaaggag      1320
     ctccctaagg ataccacatc cagcaaggcc aaggcgaagg ccaacaaggg cactgatgat      1380
     gccgccaaaa agatgcaagg tcttcaggtt taa                                   1413
//

If you have problems or comments...

PBIL Back to PBIL home page