(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE491

PENCW_16.PE491       Location/Qualifiers
FT   CDS_pept        join(1117584..1117919,1118363..1118477,1118542..1118873)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824910"
FT                   /orf_name="Pc20g04910"
FT                   /product="Putative uncharacterized protein Pc20g04910 "
FT                   /protein_id="CAP85820.1"
FT                   /db_xref="UniParc:UPI0001831923"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE99"
FT                   /transl_table=1
FT                   /translation="MVTNAIDASIAISEHRWMQYDIEEQRALECFRLILCRHLKGAQLE
FT                   LRSSISIWRPRYIQGRCYRSVSLIPKAQQYLIASLDIVRESPRLPCRHRVGRQPGAKGN
FT                   GKGKYDSTNSLLAFNKEDDFARYTPHRAPQIARTFQEEDKPSLQETKMASNNIITLPDE
FT                   LELMQLRQLAVRMTERNNTRANIIRARVAIQSAHVQIMAHYEHGQLPDVLVAVTNAIID
FT                   SLVTLEHRWTLCNIEEQGDLECFRLFLWRQLGSAGTRE"
     atggttacca acgcaataga cgccagcatt gccatttcgg agcataggtg gatgcaatat        60
     gatatcgagg aacagagggc cttggagtgc ttccgcctaa ttctttgccg ccacctgaag       120
     ggggctcaac tagaactcag atcgtcaata tcgatctgga gaccaagata cattcaaggg       180
     aggtgctaca ggtcggtatc gttgattcca aaggcgcagc agtacttgat tgcctcacta       240
     gatatagtga gggagtcacc gcgccttccg tgtcgtcatc gagtgggccg gcaacctggc       300
     gccaaaggca atgggaaagg aaagtacgac agtacaaatt cactcctggc cttcaacaag       360
     gaggacgatt tcgcgagata tactccacat agagctccac aaatagctcg cactttccaa       420
     gaagaggaca agccatcact gcaagaaact aaaatggcgt caaacaatat aatcacacta       480
     ccggacgagc tcgagcttat gcagctccgg cagcttgctg ttcggatgac agagcgtaac       540
     aatacgcggg ccaatatcat acgtgcaagg gtcgccatac aaagtgcgca cgtacagata       600
     atggcgcact acgaacacgg ccaacttccg gatgtgttag tggcggttac caacgccatt       660
     attgacagcc ttgtcacctt agagcatagg tggacactat gcaatattga ggaacagggg       720
     gatttggagt gtttccgtct gttcctttgg cgtcaattgg gctccgctgg aactagggaa       780
     tga                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page