(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE493

PENCW_16.PE493       Location/Qualifiers
FT   CDS_pept        <1120007..>1120274
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949974"
FT                   /orf_name="Pc20g04930"
FT                   /product="Pc20g04930 protein"
FT                   /protein_id="CAP85822.1"
FT                   /db_xref="UniParc:UPI0001831925"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEB8"
FT                   /transl_table=1
FT                   /translation="MVYVVKGSALVLSDGTDTETTITLRPYTEGTRGSSMIFGMSPCPL
FT                   MDIKTRMDRALYWAVAGLSQPETTGSSVNYLLPTVKTSRPPRNV"
     atggtgtatg tcgtgaaagg atcggcgctt gtgctcagtg atggcacaga tacagagacc        60
     accattactc tccgccccta cactgaaggt acccgtggat catccatgat ctttgggatg       120
     agtccttgtc cgctcatgga catcaaaact aggatggaca gagcactgta ctgggcagtt       180
     gcgggtttgt cccaaccaga aacaacaggc agctcagtca actacttact ccccactgtc       240
     aagacgtctc gccctccgcg aaatgtga                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page