(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE494

PENCW_16.PE494       Location/Qualifiers
FT   CDS_pept        join(1122310..1122338,1122773..1122801,1122847..1123087,
FT                   1123161..1123173,1123229..1123378,1123504..1123746,
FT                   1123825..1123971)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978105"
FT                   /orf_name="Pc20g04940"
FT                   /product="Putative uncharacterized protein Pc20g04940 "
FT                   /protein_id="CAP85823.1"
FT                   /db_xref="UniParc:UPI0001831926"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEB9"
FT                   /transl_table=1
FT                   /translation="MWTTAEYLLVTSDSESKTIKMTDTREVILLDNLDIAQLRILRVKM
FT                   IGRNNTRAEITRANAAIRSSHAQLMRDFDGQPELLMPATIAMNHSLALLAYMSRIKGFV
FT                   FLPTPRYDTPEVRSLVYLTHLITSYWTLPSRIVTIRGQGRILTPIGDCPLVPEGIEGNR
FT                   VELLACLSWAEQFWLNVEGDFGPGEDGESGFLLPRDLIDGIAACVRHLVSSFDNFTKAH
FT                   RRAHSLAGTNLSHVSSRSSLVVPGNLAVNFDSEWAELSVESSHCPHSRAAEEPARSWYI
FT                   LS"
     atgtggacca cagctgaata tctgctggta accagtgatt ctgagagcaa aactatcaaa        60
     atgaccgaca cccgcgaggt catccttctc gacaacctcg acatcgcgca gctccggatc       120
     cttcgtgtta agatgatcgg gcgcaacaat acccgcgccg agattactcg ggcaaacgct       180
     gcgattcgaa gcagccacgc ccaactaatg cgcgacttcg atggtcaacc agagttgtta       240
     atgccggcga caattgccat gaaccacagc ttggctcttt tggcctatat gtcgcgaatt       300
     aaaggctttg ttttcctgcc aacgccgcgc tatgataccc ccgaagtcag gagccttgtc       360
     taccttaccc acttgataac ctcctactgg accctcccct cacgaattgt caccattcga       420
     ggacaaggcc ggattctgac cccgattggg gactgcccgc tggttccgga aggaattgaa       480
     gggaaccgag tggagttgct cgcttgtctg tcctgggcgg agcagttttg gctcaatgtt       540
     gagggagact tcggtcccgg tgaagatggc gagtctggat tcttgctccc tcgagacctg       600
     atcgatggca ttgcggcatg tgtccgacac ctggtctcgt cttttgataa cttcaccaag       660
     gcacaccgtc gtgctcattc cctcgccggc acgaacctat cccatgtttc gtctcgctca       720
     tcattggtag tcccgggtaa tctcgctgtc aacttcgact cggaatgggc cgagctctcg       780
     gtggagagtt ctcactgccc ccattcgcgt gcagcagagg agccggccag gtcctggtac       840
     atcctgtcat ga                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page