(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE496

PENCW_16.PE496       Location/Qualifiers
FT   CDS_pept        join(1128059..1128830,1128924..1129735)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000216916" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129273"
FT                   /orf_name="Pc20g04960"
FT                   /product="Pc20g04960 protein"
FT                   /protein_id="CAP85825.1"
FT                   /db_xref="UniParc:UPI0001831927"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEC0"
FT                   /transl_table=1
FT                   /translation="MRPPSLLPLLGFIGLSCALSTTVDNEPVKNANHIFNVIQDSMRQW
FT                   GSSLHHNGVSFFLAGVPTGTQFYHGTSKASPVNGTEWLAFEPEHAMVFARPRRGPPPHL
FT                   PPDDPNTERHARGHGELRKRDHYNKDEKHHGPPGGRAPKESDENEAGYLHTYAAAKDLR
FT                   LLYLDGMSAAKTSKGTLDSQDAVLFAGSLDDHPSPGGQENERARLACEMAQSEWEGRID
FT                   GVLRMEAGFEIILCDFERDLIPVRITQVKRSSEEHRDDGNIHGPGGPGGPGAPPHGGPG
FT                   NGPDASRWMRAITARYNGIGGNRVSLNFNHFVTAFSHDVELFRDNSTFPRFVGLSAEER
FT                   AAIRAEVTDLVMTYHPAEVGEDWQAITDMIVIRYSKELSYFVSDSIDSIERLQSEIERV
FT                   LSPFIDYSERDDVAEIERCATQFLPSTSFESGGIAARAVYGVTHRICSSLVEAGKGRDL
FT                   MSAIRVIRDLVGYLDWATWKECRGCAANEICVVPIWPMGTVQDYDSPQCKDASNPYDQG
FT                   GESYWGGMRN"
     atgcgaccgc catcgctcct cccattactc gggtttatag gcttatcatg cgccctctca        60
     actacggtag ataacgagcc ggtcaaaaat gcaaatcaca ttttcaacgt tatccaagac       120
     tcaatgcgcc agtggggatc gtctctacac cataatggag tgtcgttctt cctcgcgggc       180
     gttcccaccg gtacccaatt ctaccacggg acatccaagg ccagtccagt gaatggtacc       240
     gagtggttag cgtttgagcc cgaacatgcc atggtcttcg cccggccgcg gcgtggccct       300
     ccgccacacc taccgcccga cgaccccaat accgagcgac atgctagagg ccatggcgaa       360
     ctgcggaagc gggatcatta taacaaagac gagaaacacc atggcccgcc aggtggtcgc       420
     gcaccgaagg aatccgatga aaacgaggcc gggtatttgc atacctatgc tgcagcaaag       480
     gatctccgcc ttttatatct cgacggtatg tctgctgcca agacatccaa gggcacgctt       540
     gattcccagg atgcggttct gttcgccggc tcgctggacg accatccgag tccgggtgga       600
     caagagaacg aacgcgccag gctagcctgc gagatggctc agagtgaatg ggagggtcgc       660
     attgacggtg tgctgcgcat ggaagccggc tttgagatta tcctgtgcga tttcgagcgc       720
     gatcttatcc ccgtgcgaat cacgcaggtc aagcgaagct ccgaggaaca ccgtgatgat       780
     ggaaatatac acgggcccgg tggtcctggt ggtcctggag cgcctcccca tggcggacct       840
     ggaaacgggc ccgacgcgtc gcgctggatg cgtgcaatta ctgcgcggta caacgggatc       900
     ggtggaaatc gtgtctcgct gaacttcaac cacttcgtga cagctttctc ccacgatgta       960
     gagctcttcc gagataattc aaccttcccc cgatttgttg gcctctctgc tgaggagcgc      1020
     gctgctattc gtgctgaagt cacggactta gtcatgacgt atcatcccgc cgaagtcggc      1080
     gaggactggc aggcgatcac cgatatgatt gtgattcggt atagcaagga gctgtcgtac      1140
     tttgtttccg acagcattga ttcaattgag cgtctgcaat ctgagattga gcgtgtcctg      1200
     tctccattca ttgactacag tgagcgggat gatgtcgctg agattgagcg ttgtgcaact      1260
     cagttcttgc cgtcgacatc tttcgagagt gggggcattg cggcgcgtgc cgtttatggt      1320
     gttactcaca gaatttgttc gtctctggtt gaggctggca aggggcggga tcttatgtct      1380
     gcgattcggg ttattcggga tctggttggg tatcttgatt gggcgacctg gaaggagtgc      1440
     cggggttgtg cggcgaatga gatctgcgtt gtccctattt ggccgatggg tacggtccag      1500
     gactatgata gtccacagtg caaggatgca tcgaatccat acgaccaagg tggagagagt      1560
     tactggggtg gaatgcgcaa ctga                                             1584
//

If you have problems or comments...

PBIL Back to PBIL home page