(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE497

PENCW_16.PE497       Location/Qualifiers
FT   CDS_pept        complement(1130025..1131053)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949975"
FT                   /orf_name="Pc20g04970"
FT                   /product="Pc20g04970 protein"
FT                   /protein_id="CAP85826.1"
FT                   /db_xref="UniParc:UPI0001831928"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEC1"
FT                   /transl_table=1
FT                   /translation="MKSFAFSAAVLASTAMALPANLANLVNNIPSGTTDALPSGVPSCL
FT                   PSGVIPSGIPLPVVSMIPTCPGAAASSAMSGLPIPTGAASDLTQGAAPNQLLSTLNGAG
FT                   HGQVLSILNQAGTSSIKMTAESELQSLMSKLPVSALQKPVGQVIQTADSVDQLNTSGGS
FT                   GLHQVTAVLDNGNAALIQLTSEVVNLLDGLGLGQVGGLIGSIVGGLESVTGYIKRDTLQ
FT                   NVLSITDVNGIAGGKNLLAQLEPSLLGGLLGGGLDLSTVQGPVGNVVAMAPSVSELKSK
FT                   IPNIPGADFIAVTTEDKASVLLVKVESTVQTLLSSLGLGSVGTTVGSIVSSASSAKGAL
FT                   PL"
     atgaagtctt tcgccttctc cgctgccgtt ctggcttcaa ctgctatggc cctgcccgcc        60
     aacctcgcca accttgttaa caacatccct tcgggcacca ccgatgctct gccttccgga       120
     gttccctctt gcttgccctc cggcgtcatc ccctcgggca tccctctgcc cgtggtctct       180
     atgatcccca cctgccccgg tgccgccgca tcctccgcca tgtccggctt gcccattcct       240
     accggtgccg cctccgactt gacccagggc gccgctccca accagcttct ctctaccctg       300
     aacggtgccg gccacggcca ggttctttcc atccttaacc aggctggaac ctccagcatc       360
     aagatgaccg ctgagtccga gctgcagagc ctgatgagca agctgcccgt cagcgccctc       420
     cagaagcccg ttggccaggt catccagaca gccgactccg ttgaccagct caacaccagc       480
     ggcggctccg gtctccacca ggtcaccgcc gtcctcgaca acggcaacgc cgccctcatc       540
     cagctgacca gcgaagttgt caacctcctc gatggccttg gtctcggcca ggtcggcggc       600
     cttatcggct ccatcgttgg tggccttgag tccgtcaccg gctacatcaa gcgtgacact       660
     ctccagaacg ttctctccat cactgatgtt aacggcattg ccggtggcaa gaacctcctc       720
     gcccagcttg agcctagtct cctcggtggt ctcctcggtg gtggtcttga cctctccact       780
     gtccagggcc ccgttggcaa cgtcgtcgcc atggccccct ccgtatccga gctgaagtcc       840
     aagatcccca acatccccgg tgctgacttc atcgccgtca ccactgagga caaggcttcc       900
     gtccttttgg tcaaggttga gagcactgtt cagactctcc tgtcctctct cggcctcggc       960
     agcgtcggca ctaccgtcgg ctccattgtc tcctccgcct cctccgccaa gggtgctctt      1020
     cccctgtaa                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page