(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE498

PENCW_16.PE498       Location/Qualifiers
FT   CDS_pept        join(1131835..1132020,1132107..1132247)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978106"
FT                   /orf_name="Pc20g04980"
FT                   /product="Putative uncharacterized protein Pc20g04980 "
FT                   /protein_id="CAP85827.1"
FT                   /db_xref="UniParc:UPI0001831929"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEC2"
FT                   /transl_table=1
FT                   /translation="MVNDSWPSVLRSLEISSLCAKRNCTKEVKLHVDNINADCNFIPPQ
FT                   WVKMSNSSVDPGRPLIAGVGLTGATKTPPASMYVVDISILLLPTLLYSVLSQFQSKLKA
FT                   NQQI"
     atggtcaatg attcgtggcc ttctgtgcta aggtcgcttg agatcagcag tttatgtgcc        60
     aaaagaaact gtaccaagga ggttaaactc cacgtggaca acattaatgc tgattgcaat       120
     tttatccctc cccagtgggt taaaatgtca aatagttcag tggatcctgg gcgcccgtta       180
     attgcggggg ttggattgac aggggctacc aaaactcctc cggcgtcgat gtatgttgta       240
     gatatttcta ttttactgct ccctactctg ctgtactccg tactgtcgca gttccagtcc       300
     aaattgaaag caaatcagca aatctga                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page