(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE499

PENCW_16.PE499       Location/Qualifiers
FT   CDS_pept        join(complement(1132900..1134429),
FT                   complement(1132740..1132844))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234554" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949976"
FT                   /orf_name="Pc20g04990"
FT                   /product="Pc20g04990 protein"
FT                   /EC_number="1.1.99.18"
FT                   /function="cellobiose dehydrogenase (acceptor) activity "
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="alcohol metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85828.1"
FT                   /db_xref="GO:0006066"
FT                   /db_xref="GO:0047735"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="UniParc:UPI000183192A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEC3"
FT                   /transl_table=1
FT                   /translation="MRIFQAGPLAIALSVFTGAASASAFQNHTYDYIVVGGGPSGIISA
FT                   EKFAQAGKKVLLLERGVGPTVATGNNETLTWDHSLTPIDLPGLSANIGALDVWNQYMCT
FT                   DTAGNAACVLGGGVTVNYMVFVHPPARDFDDKWPEGWKWKDVESAADRLYKRNPGTTLP
FT                   SADGKRYDQGLYNVLSKFLSGLGWKSVDMIAEPNEKHQIYSYPSWNVQDQMRAGPVRTY
FT                   LPAAAKLDNFHLALRTKVIRLVRSGSQVTGVEVQTPSGRSQIITVAPHGRVVLAAGALS
FT                   TPRLLWNSGIGGKAQIETAKKSGVAVPPKAQWIDLPVGVGLKDHPIFPITFNTNASFGL
FT                   VDYEGVLNGTDSRDISLYRKHSGVLTQGKHRLIFFTSEEIDGHTQYYQGSCAPTDEGVV
FT                   TMTTYMTHGLTSSGVLGLDASGNTVIEKLPYLQTAADRKAARTFIQKMVKDITAPSTGF
FT                   ELETHTNVSAILKAQTPGTHYVSSAKMGTDDGRKNGTSVVDTNAKVYGVDNLFIVDASI
FT                   HPDLPTGNIQTAVMVVAEAAAVKILSN"
     atgaggatct tccaggccgg ccctctcgcc attgcgctct ctgtttttac aggggctgcc        60
     tctgcttcag ccttccagaa ccacacctat gattatattg tggtcggtgg tggcccttcc       120
     ggtatcatca gcgccgagaa gttcgcccag gccggaaaga aagttctgct cctggagcga       180
     ggtgtcggac caaccgtggc caccgggaac aatgagaccc tcacatggga ccactcattg       240
     actcccatcg atcttccagg actgtcggcc aacatcggtg cgctcgatgt ctggaaccag       300
     tacatgtgca ccgacactgc tggcaatgct gcctgtgtgc tcggcggtgg agtaacagtc       360
     aactatatgg tcttcgttca cccgccagcc cgtgacttcg acgacaaatg gcctgagggc       420
     tggaagtgga aggatgtcga gtcggctgca gaccgactct acaagcgcaa ccccggaacc       480
     accctgccct ccgccgacgg caagcgatat gaccagggtc tgtataatgt gctatccaag       540
     ttcctcagtg gtcttggttg gaagtcggtg gatatgatcg ccgagcccaa tgagaagcac       600
     cagatctaca gctacccgtc ctggaacgtg caggaccaga tgcgtgctgg ccctgttcgc       660
     acctatctcc ccgccgctgc caagctggac aacttccacc ttgctctccg aaccaaagtg       720
     attcgcttgg tccgttccgg tagccaggtc actggtgtcg aggttcagac tccctcgggc       780
     cgctcccaga tcatcacggt tgctccgcac ggtcgcgtgg tgctcgctgc gggcgctctg       840
     tcaaccccgc gtctgttgtg gaactctggt attggcggca aggcccagat cgagactgcg       900
     aagaagagcg gagttgccgt gcctcccaag gctcagtgga ttgacctgcc tgtcggtgtc       960
     ggtctcaagg accaccccat tttcccgatc accttcaaca ccaacgcatc atttggactt      1020
     gtcgactacg aaggtgtact caatggaacc gactctcgcg atatctccct ctaccgcaag      1080
     cacagcggtg tcctgaccca gggcaagcac cgcttgatct tcttcacgtc ggaggagatt      1140
     gatggccaca cccagtacta ccagggctcg tgcgcgccta ctgacgaggg cgtggtaacc      1200
     atgaccacgt acatgactca cggcctcacc tcatccggtg tcctgggact tgatgccagc      1260
     ggaaacactg tcattgagaa gttgccctac ctccagactg ctgctgaccg gaaggccgcc      1320
     cgcaccttta tccagaagat ggtcaaggac atcaccgccc cctccactgg ctttgagctt      1380
     gagactcaca ccaatgtttc ggccatcttg aaagcccaaa cccctggtac gcactacgtc      1440
     agcagtgcga agatgggtac cgatgatggc cgtaagaacg gcacttccgt tgtcgatact      1500
     aatgctaagg tctacggagt ggataacctg ttcattgttg atgccagtat ccatcctgac      1560
     ctcccgaccg gcaacattca aaccgccgtc atggtggtgg ctgaagctgc agcagttaag      1620
     attttgtcga actaa                                                       1635
//

If you have problems or comments...

PBIL Back to PBIL home page