(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE5

PENCW_16.PE5         Location/Qualifiers
FT   CDS_pept        join(complement(17945..20094),complement(17741..17783))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217336" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977327"
FT                   /orf_name="Pc20g00050"
FT                   /product="Pc20g00050 protein"
FT                   /protein_id="CAP85334.1"
FT                   /db_xref="UniParc:UPI000183182B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HER3"
FT                   /transl_table=1
FT                   /translation="METADGAVHLRQLPRSSDNRQDAPEYTRHDSSSESPPLHDEELPS
FT                   YSEARSTGQILGRGHSTLLHRSAWVSVFTIIYVGLVLYAWAMTVILSIRPLKDKTWAYS
FT                   FETSRSNYYYEADFDQERKIYRSMRTIQTFIQVVTLPWISTVCASAAVIYAQNQKDPMG
FT                   LRLRQVTTLADRRWMDFSLYPALMYGKWRQYGSTLLATAIFIWVFGLIIFPIQSVFLSS
FT                   QSVKVRTLTQQSASIYDFSPARSLYSSHNTGKDVLRVRNALNKANGDIYQPNLWSNNSG
FT                   VQFLTLNDLSSQTYYSQVPSGFNTGLIRQFAPRVNSTATYETIRASDFPVDCSSRPGAF
FT                   YADYSSSYSPRTHSTSSYSWGVTACMPANMTKSPWQMARNRQDFSEVLYLNMTQEEYRS
FT                   GNYQYLFQVTVNTTAGFFELPNYMNKGVPGPLLDQDPVELCDQHCLSQLNTFYSGSYYR
FT                   RDGVTVEGTLKAASLDPFSTDRKGPLLSAALASFGPGSFIDTFIATAAALEADDKVTGD
FT                   VSSNLRYACVANPPLTNLMGSSPLECVSVGIDIDGNWYPVGSEIARWISLFQKDAKSIP
FT                   KAFTSAAFLANQEFLSSQRGKWSIAHDLGADMNLPSISPAGTIVVTVLMALYLLPLLAL
FT                   SLYAGLSHRWTERLDSFVMLRFGAFAGDKVFPLLIGRKSDKVDELDEMSGVVRDVATYP
FT                   GDEVIKIGRLGFGEGSKLREGRRSKHSRQLPMLFHD"
     atggagacag cagacggtgc ggtccatcta cggcaacttc cgagaagctc ggacaatcgc        60
     caagacgcac ctgaatacac tagacacgat tcctcgtccg agtctccccc gctacatgat       120
     gaggagcttc catcatatag cgaggcgcgc tcaacgggac aaattctagg acgagggcac       180
     agtactttgc ttcatcgatc ggcctgggta tctgtattca cgatcattta cgtgggcctc       240
     gtcctctatg cctgggccat gactgttata ctgtcaatcc gccccttgaa agacaagacc       300
     tgggcgtact cgtttgaaac ctcacgttcc aattattact acgaagcaga tttcgatcaa       360
     gagagaaaga tctatcgctc tatgcggact attcagacct ttattcaagt tgttactctt       420
     ccctggattt ccacagtgtg tgctagtgcc gctgtaatct atgcgcagaa tcaaaaggat       480
     cctatgggcc ttcggctacg ccaagtcaca acgttggctg accgcaggtg gatggacttt       540
     tctttgtatc cagcactgat gtacgggaaa tggaggcaat acggtagcac gctactggcc       600
     accgcaatct tcatctgggt gtttggtctc atcatatttc ccatccagtc ggtctttctc       660
     agttcacagt ctgtcaaagt ccggactttg acccaacaga gtgccagtat ctatgacttc       720
     agcccggctc gttctttgta ttcatcgcac aataccggca aggacgtgtt gagagtccgc       780
     aatgccttga acaaagcgaa tggcgatatc taccaaccta acctgtggag taacaacagt       840
     ggagtccaat tcttgactct caacgatctg tcttctcaga cgtactactc ccaggtcccg       900
     agtggcttta atacaggatt gattcgtcaa tttgctccac gtgtgaactc tacagctaca       960
     tacgagacca taagagcatc tgatttcccg gtggactgca gttcacgccc aggggcattt      1020
     tatgccgact attcatcttc ttactcgccg cgcactcatt ctacttcaag ttattcttgg      1080
     ggcgtcactg catgcatgcc agcaaatatg acgaaatctc cttggcagat ggcacgtaac      1140
     cggcaggact tctctgaggt cctctatctc aacatgacac aagaagagta ccgctcagga      1200
     aattatcaat atcttttcca ggtcactgtc aacaccactg ccggcttctt tgaattaccc      1260
     aactatatga acaagggtgt acccggtccc ttactggacc aagatccagt ggaactttgt      1320
     gaccagcact gtttatccca actcaacact ttctattcgg gaagctatta ccgccgtgat      1380
     ggggtcacag tggaaggcac tctcaaagcc gcatcgcttg atcccttctc aacagaccgc      1440
     aaaggaccgt tgttatcggc cgccctggca agctttggcc ctggctcttt tatcgacaca      1500
     ttcattgcaa ccgccgcagc ccttgaagca gacgacaaag ttacaggcga cgtgtcgtca      1560
     aacttgagat acgcctgcgt tgcgaacccc ccactcacca atctaatggg gtcctccccg      1620
     ctggagtgcg tgtctgttgg gatcgatata gatggcaact ggtaccctgt tggatcagag      1680
     attgcgcgat ggattagtct attccaaaaa gacgcgaagt caattccgaa agccttcaca      1740
     tcagcggctt tccttgccaa tcaggaattc ctttccagtc aaaggggcaa atggtctatc      1800
     gcccatgatt taggcgccga tatgaatctt ccgtcaattt ctcccgcggg aaccatcgta      1860
     gtcaccgtct tgatggcgct ttacttgcta ccgctgttgg ctttgtcact ctacgcaggt      1920
     ctttcccatc gatggaccga acgattggat tccttcgtga tgctgcgctt tggcgccttt      1980
     gctggtgata aggtctttcc tttgctcatt ggacgcaaga gtgataaagt tgatgagctg      2040
     gacgagatgt ctggtgttgt tcgggatgtg gcaacatacc ctggcgacga ggttattaag      2100
     attgggaggt tggggttcgg cgaaggcagc aagttgcgag aaggccgtcg ctccaaacat      2160
     tctcgacagc ttccaatgct atttcacgac tag                                   2193
//

If you have problems or comments...

PBIL Back to PBIL home page