(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE500

PENCW_16.PE500       Location/Qualifiers
FT   CDS_pept        1136437..1137414
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000184929" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949977"
FT                   /orf_name="Pc20g05000"
FT                   /product="Pc20g05000 protein"
FT                   /protein_id="CAP85829.1"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000183192B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEC4"
FT                   /transl_table=1
FT                   /translation="MSSPAARLIPASSRTLLLTFDAFGTLFHPRLPVPEQYAATAHQFG
FT                   LSRTAVTPDKLATAFKDTFRAQMRQYPNYGRADVLRGQYGGPRQWWEEVIRGSFGRVLS
FT                   TENGETRPETPKEHIPDGMVEALLDRFAGAEGYALYDDVLPFFRRMRKLKSANKWSFDR
FT                   IIVGVVSNSDDRVPVVLKSLGLTVGDMRADQDQSSMDLPGFEVRGMKKDVAGEHGKDHA
FT                   DGNLDLDIDMVITSYEAGEEKPHRLIFDVARRQALKVARPWLTSRTKFKSVHVGDDFKK
FT                   DYQGASDAGWESYLLPRDSHGAEGSEAKQFPDLLGLADKLDLFP"
     atgtcaagtc cagctgcccg ccttataccg gcatcttcac gcactcttct cctcaccttc        60
     gacgcgttcg gcaccctctt ccacccgcgt ctccccgtcc ccgagcaata tgccgcgacc       120
     gcgcatcaat tcggattatc gcgcacagcc gtcaccccgg acaaactcgc aaccgcattc       180
     aaggacacct ttcgtgcgca gatgcgtcag tacccaaatt acggccgtgc ggatgttctc       240
     cgaggccaat acggggggcc gaggcagtgg tgggaggagg tgattagggg gagtttcggg       300
     cgtgttttat ctacagagaa tggggagacg cgtcctgaaa cacccaaaga gcatattcct       360
     gacggcatgg tggaagctct actagatcgg ttcgctggtg ccgaggggta tgcgctttat       420
     gacgatgtgc tacccttctt ccgccgaatg cgcaaactga agtccgcgaa taagtggtcg       480
     tttgatagga taatagtggg agttgtgtcc aattcggatg accgcgtccc tgtcgtactg       540
     aagtcgttgg ggttgactgt tggtgatatg cgcgccgacc aggatcaatc cagcatggat       600
     cttcccgggt tcgaggtacg aggtatgaaa aaagatgttg caggggaaca tggcaaagat       660
     catgcggacg gcaacttgga cctcgatatt gatatggtca ttactagtta tgaggcgggc       720
     gaagagaaac ctcatcgctt gatctttgac gtggcgagac ggcaggctct taaggttgcc       780
     cggccatggt tgaccagcag aaccaaattt aaatctgtgc acgtgggaga cgattttaag       840
     aaggattatc agggtgcaag cgatgcaggc tgggagagct atttgcttcc tcgagattct       900
     catggtgccg agggatctga agcgaaacaa ttcccagatc ttctggggtt ggctgataaa       960
     ttggaccttt tcccataa                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page