(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE501

PENCW_16.PE501       Location/Qualifiers
FT   CDS_pept        join(1138558..1138635,1138691..1138876,1138984..1139095,
FT                   1139223..1139349,1139401..1139692)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141498" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824911"
FT                   /orf_name="Pc20g05010"
FT                   /product="Pc20g05010 protein"
FT                   /function="coenzyme binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="fatty acid metabolic process "
FT                   /protein_id="CAP85830.1"
FT                   /db_xref="GO:0006631"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="UniParc:UPI000183192C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEC5"
FT                   /transl_table=1
FT                   /translation="MEGVQKPQGSVVIIGAGTQGRRLAHMWSSRGGTVRLVDLQEQQLE
FT                   DGLKYVEQLRADATDHEGDWGRIETSQPASLQSTLKDSWLVVELAPESTIIASNSSSYG
FT                   IFEILEGMSLKNNKRVMSAHCSIEIMGHKDSDPKLIALVLEQCKEHGFSPFYVRENSIG
FT                   YIYNRIWAAIKRETLLTLSEGVATPKEIDAIFKDVLKTPKGPCEQMDVVGLDVVLDIEN
FT                   HYAESRSGIPTEPRDYLRRMIQGGSLGVKNGRGFYDYEDQNK"
     atggaaggtg tccaaaagcc acaggggtca gttgtaatca ttggagctgg tactcaaggt        60
     agacgtcttg cgcacatgtg gtcaagccga ggcggcaccg tccgtctggt agatctccaa       120
     gagcaacagc tcgaagatgg tctgaagtat gtggagcagc ttcgtgcgga tgctacagac       180
     catgaaggag actgggggag gatcgagact tcccagcccg cctctttgca atccacactg       240
     aaggattcat ggctcgttgt cgagcttgca cctgaaagca caatcattgc ttcgaactcg       300
     agtagctacg gaatctttga gatcctcgag ggcatgagct tgaaaaataa caaaagagtt       360
     atgagcgcgc actgctcaat tgaaatcatg ggccacaagg atagcgatcc taagctgatt       420
     gccctggtcc tggaacaatg taaagaacat ggtttctcac ctttctacgt cagagaaaac       480
     tctatcggct acatatacaa cagaatctgg gctgctatca agcgcgagac tcttctcaca       540
     ttgtctgaag gtgttgccac gcccaaggaa attgatgcca ttttcaaaga cgtcctaaag       600
     acgcctaagg gcccctgtga acagatggat gttgtcggtt tggatgttgt gttggatatt       660
     gagaatcact acgccgaatc tcggagtggt attcctactg agccgcggga ctaccttcgg       720
     agaatgattc aaggtggaag tctgggtgtc aagaatggcc gaggattcta cgactatgaa       780
     gatcagaaca aatga                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page