(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE502

PENCW_16.PE502       Location/Qualifiers
FT   CDS_pept        join(complement(1141313..1144182),
FT                   complement(1140193..1141264))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184940" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978107"
FT                   /orf_name="Pc20g05020"
FT                   /product="Pc20g05020 protein"
FT                   /protein_id="CAP85831.1"
FT                   /db_xref="InterPro:IPR018564"
FT                   /db_xref="UniParc:UPI00018319F6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEC6"
FT                   /transl_table=1
FT                   /translation="MSSPSTPRSTRSASPAGDSPNIITPGQKIKSMMAQFDSDSEDDAQ
FT                   IAKSTAAVSKLDLGRGGVPAADARENRPLHDSEDNSDSADEVFRPKGRMAARLQGNSRP
FT                   VEPEDEKSAFSRVSKAFRSEKEQGEKPQRTESQPTPIGESSDDDDLPTAGPRRKHKSTT
FT                   NSPNSNNRTSQTPPRSRADSPLFVSSPGEPHDDPNAEDTEHAAETKPKGNARFLSLVAQ
FT                   KRKEREEREKAEAERKKAIRRVQMEQLSSQVNSGEESGADDPSTASKLSQKARQPRKAS
FT                   KKALDEMRQETQRMSRNMQLAHQAKTKKKITKESLFAKFNFMQPDPPVEQLAANSSSAV
FT                   GSQNSSDGERAKTKDTPHTSPVLGHLDPSKASADFENAQVQAADVDMDADTEDLPAPKD
FT                   LLAPNQHPALSKDTAVQDVSLSIPEPKSEDGKSKRVSRPLTQPPIRVLLSRQDVAAHQK
FT                   DSDDSDSDLEVVTSPGKCRRIAAFENLPTRQSHEDPSMTKLKALAHLTSPTRKMASMNS
FT                   AELSANLLWRARQQAAKERRERIEELRAKGVVIETAEERAAMEDDMENLVDKARKEADE
FT                   IRRLEKAAGKKANGDDDEEEDDDYELSGSDQERDAEVDDEEDEEEEHERVNGGGDFVEH
FT                   EADEDDDSADDESEAEAAPSDAENEVPAPRRRRRTRVVSDNEDEDQPQPPSTPVRASSH
FT                   APQSAERPNFLGMGTSGDTSLGLTQAFASTLDGNGAGTQAESATMPFSLPDPGQPVPQL
FT                   RKEESEVLVPDSQPQPQDKDFMEGYAQSVTRVSESPAPYAFSEFSQSQLPDPTQDEGFV
FT                   FSPFDPAKRFRGTPPMSTVDTVLVGQTQSPIADRKRKMLRRGRATELPQVDENDDEGGF
FT                   EISANAFDVMKKDKALKKKPAPQYNKNNSKAKEIVDEAAEESEDEYAGLGGNSDESDGE
FT                   ENAIDRQMINDNSGEVVDEKQLAALNAVHDRNRDEKDVAKLMRDITTGALRRRKNADDD
FT                   FDLDDSDDEHLARRREKQREFAKMRRALLADEKIGEIAENPKKAAFFKAVEDREVDDDF
FT                   NIDFLEEEDHGSQGEASQDAASGEQSNDTASDGQNRKRPLEPSAEDATNRPPPRLRRTT
FT                   ASAMSKKPATIAEIRETLSFLTETPEYDSFQEDASLDEVEHDQEDEGTPGAEVQGHEDQ
FT                   PHSDNTFAKPSHPRRTRGVVVDRLALLRQASSNSATGTNSGSANSKLAFHSGSGGEGPI
FT                   GFRPPQLLRRVTTGSSSSSSSSASNRVSKAAASGPKKGGAVNSYTAAREREREKELRIK
FT                   QRSGGSNIAKLLGKHTGGGLGALDKGQWD"
     atgtcctcac catccacacc gcgatcgacg cgttccgcgt cgcctgcggg cgattcgccg        60
     aacattatta cgcccggcca gaagatcaaa tccatgatgg cgcaattcga cagcgattcg       120
     gaggatgacg ctcaaattgc caagtcaaca gctgctgtct cgaagcttga tctagggcgt       180
     ggtggagtgc cggctgctga tgcacgcgag aatcgcccat tgcacgactc agaagacaac       240
     tcagacagcg cagatgaagt tttccgacca aagggccgta tggctgcacg tttacagggt       300
     aattctagac cagtcgaacc tgaggatgaa aagtcagcat tttcccgcgt gtcaaaggcc       360
     ttccgatcag aaaaagaaca gggcgagaaa ccccagcgga cagaatcaca gcccacaccc       420
     attggtgaat ctagcgatga cgacgatcta cctacggctg gcccgaggag aaagcataag       480
     tccacaacca actccccaaa ctccaacaac agaacaagcc aaacccctcc ccgttcaagg       540
     gccgactctc ctctctttgt atcctctccg ggcgaaccgc acgacgaccc aaacgccgaa       600
     gacaccgaac atgccgccga aacgaagccc aaaggaaacg cccgtttcct gtctcttgtc       660
     gctcaaaaac gtaaggaacg cgaggagcga gagaaagccg aggccgaaag gaagaaggcc       720
     atccgaaggg tccaaatgga gcaactcagc tcgcaggtaa actcgggcga ggaaagcggt       780
     gctgatgatc cgagtactgc aagcaagctc tcccaaaagg ctcgtcagcc ccggaaagcc       840
     agcaagaaag cactggatga gatgaggcag gagactcagc gaatgagccg taacatgcag       900
     ctagctcacc aggccaagac aaaaaagaag atcaccaagg aaagcctatt cgccaaattt       960
     aacttcatgc aacctgatcc cccggtcgag cagctcgcgg caaattcatc gtcagcggtc      1020
     ggatcgcaaa actcctctga tggagaacgc gccaaaacca aagatactcc gcatacctct      1080
     ccggttctcg gccatttgga tcccagcaag gcgagcgcag atttcgagaa tgcccaagtt      1140
     caagcagctg atgtggatat ggatgcggac actgaagatt tgcctgcccc gaaagaccta      1200
     ctggcgccaa accagcatcc tgcattgtcc aaggacactg cagtccaaga tgtctcgctc      1260
     tctatacctg agcccaaatc cgaagatggc aaatcgaaga gagtctcacg cccgctgaca      1320
     caaccaccta tccgcgtgct gctttccagg caagacgttg ctgcacatca gaaggactct      1380
     gacgattccg atagcgatct tgaggtggta acatcccctg gcaagtgccg tcgtattgca      1440
     gcgttcgaaa atctgcctac gagacagtcg catgaagacc cctctatgac caagctcaag      1500
     gcattggcac atctgacatc tcctacccgg aaaatggctt ccatgaactc cgctgagctt      1560
     tccgcaaatc tattatggcg ggcccggcag caagcggcca aggagcgccg ggagcggatt      1620
     gaagagctca gggctaaggg agtcgtcatt gaaacagctg aggagcgtgc agcgatggag      1680
     gatgacatgg aaaatcttgt tgacaaagca cgcaaagagg cagacgaaat tcgccggctg      1740
     gagaaagctg ctggaaagaa ggccaacggt gacgatgacg aagaagagga tgatgattac      1800
     gagctctccg gctctgatca ggagcgcgac gctgaagtag atgacgaaga agacgaagaa      1860
     gaagaacacg agcgcgtcaa cggcggcggg gatttcgttg agcatgaggc tgatgaagac      1920
     gatgattcgg ctgacgacga gagcgaggcc gaggccgccc cctcagatgc agagaacgag      1980
     gtgcctgctc cgagacggag gcgacgaact cgagtggtta gcgataacga agacgaagac      2040
     caaccacaac caccttcaac gcctgtgaga gcctcgagtc atgccccgca gtccgccgaa      2100
     cgaccaaact tccttggcat gggaacatca ggcgatacgt ccctaggtct tacccaggca      2160
     tttgcctcca cgttggatgg caatggtgct ggcacccaag cggaatctgc cactatgcca      2220
     ttctctctcc cagaccctgg tcagcctgtt cctcaactcc gaaaagaaga atctgaggtc      2280
     cttgtcccag acagccagcc ccagccccag gacaaagact ttatggaggg ctacgcgcaa      2340
     agtgtgacca gagtatcaga gtcgcctgcg ccatatgcgt tctcggagtt ttcccaatcc      2400
     cagctgcccg accctaccca ggatgagggc tttgtattct caccattcga ccccgcaaaa      2460
     agattcaggg gtaccccgcc catgtctacc gtcgacacag tccttgtggg tcaaacccag      2520
     tcgcccattg ctgaccgcaa gcgcaaaatg ttgcggcgag gacgtgcaac tgaacttcct      2580
     caagtcgacg agaatgatga tgagggtggc tttgagatca gcgccaatgc cttcgatgtc      2640
     atgaagaagg ataaggctct aaagaagaag cctgctccgc agtacaacaa gaataacagc      2700
     aaggcgaaag aaattgtcga cgaggccgcc gaagaatccg aagatgaata tgcaggcctt      2760
     gggggtaaca gtgacgagag cgacggtgaa gaaaatgcca ttgatcgcca aatgatcaat      2820
     gataacagtg gcgaggtggt tgatgagaag caacttgccg cactcaacgc ggttcacgat      2880
     cgcaaccgcg acgaaaaaga tgtcgccaag ctgatgagag atatcaccac tggagcccta      2940
     cgtcgtcgca agaatgcgga tgatgacttt gacctcgacg actcggacga tgagcaccta      3000
     gcacgtcgcc gtgagaagca acgcgagttc gcaaagatgc gccgcgctct ccttgcagac      3060
     gagaaaatcg gcgagattgc cgagaatccc aagaaggccg cattcttcaa ggccgttgag      3120
     gatcgcgaag ttgatgatga cttcaatatc gacttcttgg aggaagaaga ccacggctct      3180
     cagggagaag catcgcagga cgctgcttcg ggagaacagt cgaatgatac agcgagcgat      3240
     ggccagaacc gcaagcgtcc tctcgaacca tcagctgaag atgcaactaa ccgtccgccg      3300
     cctcgccttc gtcgcaccac cgctagcgca atgtcgaaga aaccagctac gatagcagag      3360
     attcgcgaaa cgttgtcctt cctcactgaa acccccgaat acgactcatt ccaggaagac      3420
     gcttctctcg atgaggtaga acacgaccaa gaagacgaag gcacccccgg cgcagaagtc      3480
     caaggtcatg aagatcagcc ccactcagac aataccttcg ccaaacccag ccacccacgc      3540
     cgcacgcgcg gagtcgtggt cgaccgcctt gccctcctcc gacaagcatc ctccaactcc      3600
     gccacaggca cgaactccgg ctctgccaac tccaagcttg cattccacag cggcagcggt      3660
     ggagagggtc ctattggatt ccgccctcct caacttctgc gtcgtgttac gactggctcc      3720
     tcatcttcca gtagctcgag cgcctccaac cgtgtctcca aggctgcagc ttcgggtccc      3780
     aagaagggcg gcgctgtcaa ctcttataca gctgcgcgtg aacgggagcg tgagaaggag      3840
     ctccgtatca aacagcgcag tgggggatcc aacattgcca agttgctggg taagcatact      3900
     ggtggtggtt tgggtgcgtt ggataagggc caatgggact ga                         3942
//

If you have problems or comments...

PBIL Back to PBIL home page