(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE503

PENCW_16.PE503       Location/Qualifiers
FT   CDS_pept        join(complement(1146764..1146972),
FT                   complement(1145955..1146703),complement(1145765..1145904),
FT                   complement(1144985..1145716))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184951" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672212"
FT                   /orf_name="Pc20g05030"
FT                   /product="Pc20g05030 protein"
FT                   /function="DNA binding"
FT                   /biological_process="histone modification"
FT                   /biological_process="transcription initiation, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85832.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006352"
FT                   /db_xref="GO:0016570"
FT                   /db_xref="InterPro:IPR004343"
FT                   /db_xref="UniParc:UPI00018319F7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEC7"
FT                   /transl_table=1
FT                   /translation="MADDLDAELLALAGDSEEETSPPPKSPAHSSSSHVQERDTSPAPM
FT                   GRKGTAKPVSRRSRKPVKDESEGEISDDGSRHSLQSAPMSESESEADNSDDNDEDRPIF
FT                   PYEKLYYSAQDKKDIMAMPEIQREETLSERAQQVDRHNQDLALRRLLASRSREEARAAK
FT                   KAKRKAGSAGLDDNQRKSSRQKTTLGGRKVGETSGAIEAYKRQREQKGKRDELRRRDPT
FT                   KSRRRSRSVGSDISEEDADAESDLELDDRVGRAPSIPKDDPPAELREIRRAQIGRNNFA
FT                   KVCFYPGFENAMIGCYARLSIGPHPETGQNEYRLGLITGISQGKPYALEGENGRSFVTD
FT                   QYVKLAHGKAVRDFPFVTFSNSPLTEAEYRRYVQTLAVEDCKMATKSKVESKVADINRL
FT                   LNHTFTREELNEKLRRQGAFDEKKNVLNRLELERNLEFAKVNGNVEEAEKIEAELQKLA
FT                   TPALSWGTSLVKKEADKGLSEAERVHQINLRNQKLNIENGRRAQLEERKAAKKAAQAVA
FT                   RGEAAPNPFMRVRTVAKTHHDVNGVHKAAAAEAASVDSQKDTPAKSDGSPAQKATPGSR
FT                   VTPKKPKNGFMISYRNTDDENIAALDMDIDIEI"
     atggcggacg atttggatgc tgagctgctc gctttggcgg gtgactctga ggaggaaact        60
     tcaccacccc ccaaatcacc agcacactct tcctcttcac acgtccaaga gcgagatacc       120
     tcacctgcac ccatgggtcg caaaggaact gccaaaccgg tcagccgccg atcccgcaag       180
     cctgtgaaag atgaatcaga gggtgaaatc tctgacgatg gctctcgtca ctcacttcag       240
     tctgccccca tgtccgagtc cgagtcagag gccgacaact ccgacgacaa tgacgaggat       300
     cgccccattt tcccatacga gaaattatac tactcggccc aggacaaaaa ggacattatg       360
     gctatgcctg agatccagcg cgaggaaacc ctgtccgaac gtgcccagca agtcgatcgc       420
     cacaaccagg atctagctct gcgtcgcctt ctagcatctc gatcgcgcga ggaagcgcgc       480
     gcggccaaga aagccaagcg aaaggcaggg tccgccggct tggatgataa ccagcgcaag       540
     agctcgcgcc agaagaccac tcttggtggc cgcaaagtcg gagaaacgtc cggagccatc       600
     gaagcctaca agcgccagcg cgagcaaaag ggcaagcggg atgaactccg tcgccgagac       660
     cctacaaaat cgcgtcggcg ttcgcgctcc gtgggatcag atatttctga ggaagatgct       720
     gatgctgaga gtgatcttga attggatgac cgtgttggcc gtgctccttc cattcccaag       780
     gatgacccac ccgccgagct tcgtgaaatt cgccgcgctc aaattggacg taataacttt       840
     gccaaagtct gcttctaccc cggattcgag aatgctatga ttggctgcta cgctcggctg       900
     agtattggcc cgcaccccga aactggccag aatgaatatc gcctaggttt gattactgga       960
     atttctcagg gcaagccata cgccttggag ggcgaaaacg gtcgctcatt tgtcacggat      1020
     cagtatgtca agttggcaca tggaaaggct gtcagagact tcccgttcgt cactttctcg      1080
     aactctccac ttactgaggc cgagtaccgc cgttatgttc agaccctcgc tgttgaggat      1140
     tgcaagatgg ctacaaagag caaggttgaa tcgaaggtcg ccgatattaa ccgtcttctc      1200
     aaccacacat tcactcggga ggagttgaac gagaagctcc gtcgccaggg tgctttcgac      1260
     gagaagaaga acgtgcttaa tcgcctagaa ctcgaaagaa atctggaatt cgccaaggtc      1320
     aacggaaatg ttgaggaggc cgagaagatc gaggcggaac tgcagaaact ggctactccg      1380
     gccctgtcct ggggaacaag tctcgtcaag aaagaggccg acaagggtct atcggaagcc      1440
     gaacgagtcc accagatcaa ccttcgcaac caaaagctta atatcgagaa cggtcgccgt      1500
     gcccagctcg aggagagaaa ggccgctaag aaggcagccc aagctgtggc acgcggagag      1560
     gctgccccaa atcccttcat gcgtgtgcga acagtggcca aaactcacca cgatgtcaac      1620
     ggagtacaca aagccgctgc tgccgaggcc gcttctgtgg acagccagaa agatacccct      1680
     gcgaaatccg atggcagtcc cgcacaaaag gcaactccgg gctctcgcgt cactccaaag      1740
     aagcccaaga atggcttcat gataagttat cgcaatactg acgatgagaa cattgcggcc      1800
     ctggatatgg acatcgacat cgagatttag                                       1830
//

If you have problems or comments...

PBIL Back to PBIL home page