(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE504

PENCW_16.PE504       Location/Qualifiers
FT   CDS_pept        1147418..1148161
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184972" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824912"
FT                   /orf_name="Pc20g05040"
FT                   /product="Pc20g05040 protein"
FT                   /function="oxidoreductase activity"
FT                   /function="transition metal ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="protein metabolic process "
FT                   /biological_process="ubiquinone biosynthetic process "
FT                   /protein_id="CAP85833.1"
FT                   /db_xref="GO:0006744"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0019538"
FT                   /db_xref="GO:0046914"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011566"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniParc:UPI00018319F8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEC8"
FT                   /transl_table=1
FT                   /translation="MLSSPILRRCALTHCRHSAPAATPIFLDFLAPSTFKHGQCRQAST
FT                   TAGTPGGSKPLYVLSKEQREFMDSALRVNQAGEIAATLIYKAQTPQIVRSYPHLRPLMK
FT                   HMYDQEAGHLKTFNHLIAKHQIRPTAMSPAWEVAATFLGWSTAALGREAAMACTEAVET
FT                   EIGSHYNDQVREILSWEADAERRGEELDEELKEMLATFRRIRDEELEHLDHAVANDSKE
FT                   AKPYDPLVDVIRFGCRAAIKISEKV"
     atgttgtctt cacctattct gcgcagatgc gccttgacac attgccgtca ttctgctcca        60
     gcagcaacac ctatttttct cgatttcctc gctccgtcaa catttaagca tggccaatgt       120
     cggcaggctt caacaaccgc cggaactccc ggtggctcca aacctctata tgttctcagc       180
     aaagagcaac gggaattcat ggacagcgct ttgcgagtga atcaagctgg tgaaattgcc       240
     gcgacgctga tctacaaagc ccaaacgcct cagatcgtcc gatcatatcc ccacctccga       300
     cccttgatga aacacatgta cgaccaggaa gctgggcacc tcaagacctt caatcacctc       360
     atcgccaagc atcagattcg accgaccgcc atgtctccgg catgggaggt agctgccacc       420
     tttttgggtt ggtcgactgc ggcactgggt cgcgaagctg caatggcgtg caccgaagcc       480
     gtggagacgg aaattggatc acactacaac gatcaagtaa gagagattct gtcttgggag       540
     gcagatgccg agagacgggg ggaggagctg gacgaggaac tcaaagaaat gttggccaca       600
     ttccggagaa ttcgcgacga ggaattagaa catctcgacc atgccgtagc caacgactca       660
     aaggaggcga agccctacga tccactcgtg gatgtcattc gttttggatg cagggctgct       720
     atcaagatca gtgaaaaagt ctga                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page